KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1131Help
Entry
LBU_1131          CDS       T01957                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
ldl00670  One carbon pool by folate
ldl01100  Metabolic pathways
ldl01120  Microbial metabolism in diverse environments
ldl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ldl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LBU_1131
Enzymes [BR:ldl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LBU_1131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ADY85316
UniProt: F0K301
Position
complement(1181834..1182499)
Genome map
AA seq 221 aa AA seqDB search
MYQTREQVLNLLDNLSEFNVKNILGLRGDKIPGKQPVGDFNHANDLVAFVHQNRPDFSIA
SACYPNCHPEATGFVDDIAHLRTKVDAGADYLISQLFFDNQAFYDFQEKAEIAGIHVPIE
AGIMPCTNKKQIERITQITGVPLPKKFSAILNRYQNSKEAMREAGIAFAVDQIIDLVSEG
VDGIHLYTMNNADIAERIWNATKSVFDAANARTRTTIKHRS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttgtaccaaacccgcgaacaggttttaaacctactggataatctctcagaatttaatgtt
aaaaacattttaggccttcgcggtgataaaattcccggaaaacaaccagttggtgacttt
aatcacgccaatgatctggtagcctttgttcatcaaaatcgaccagactttagcattgcc
agtgcttgttacccaaattgtcaccctgaggccactgggtttgttgatgatattgcccat
ttaagaaccaaagtcgatgctggcgccgattacctgatcagtcaactatttttcgataat
caagctttttatgatttccaggaaaaggctgaaattgccgggattcacgtcccaatcgaa
gccggcatcatgccgtgtaccaacaagaaacaaattgaacgaattactcaaattacaggg
gttccactacctaaaaagttcagtgctattttaaatcgttatcagaacagtaaggaagca
atgcgggaggccggaattgcgttcgctgttgatcaaattatcgatcttgtttctgaaggc
gttgacggaattcacctttataccatgaataatgccgacattgccgaacgaatctggaat
gcgactaaatcagtatttgatgctgctaatgcaagaacccggacaactataaagcaccgc
tcttaa

DBGET integrated database retrieval system