KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1502Help
Entry
LBU_1502          CDS       T01957                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
ldl00010  Glycolysis / Gluconeogenesis
ldl00030  Pentose phosphate pathway
ldl00051  Fructose and mannose metabolism
ldl00052  Galactose metabolism
ldl00680  Methane metabolism
ldl01100  Metabolic pathways
ldl01110  Biosynthesis of secondary metabolites
ldl01120  Microbial metabolism in diverse environments
ldl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBU_1502
   00030 Pentose phosphate pathway
    LBU_1502
   00051 Fructose and mannose metabolism
    LBU_1502
   00052 Galactose metabolism
    LBU_1502
  Energy metabolism
   00680 Methane metabolism
    LBU_1502
Enzymes [BR:ldl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LBU_1502
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     LBU_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADY85687
UniProt: F0JZR4
Position
1559027..1560106
Genome map
AA seq 359 aa AA seqDB search
MTLRVGILTSGGDCQALNATMRGLSKTLYNCVDDVEIIGFKRGYYGLMHEDYVKMKPRDF
SGIINEGGTILGTSRQPFKEMRVIVDGFDKVAAMKKTYKKLNLDALAVLGGNGSLKSANM
LAQEGLNVIGLPKTIDNDTWGTDYTFGFQSAIDIATRYLDDIHTTAQSHSRVFVVEVMGH
KVGHITLAAGLAAGSDIILLPEIPYDINVVAKKVKERQKSGKGFTVIAAAEGAISKEDAT
LSKKKYKAKVAARNGASVVNEIAAQLQEVLPDAEIRTAVIGHAQRGGRPDAYDRQISTRF
GIEGARLIMNRSFGRLVVLKQGEVDSIALEDTAGKLKYVDPNGKTVSNARLMGVTFGDK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactttacgagttggtattttgacgagcggcggcgactgccaggcgctcaacgcgacc
atgcgggggctgtccaagaccctttacaactgtgtcgatgacgtggaaataatcggtttc
aagcggggctactacggcttgatgcatgaagactacgtcaagatgaagccgcgggacttc
tccggcatcatcaacgaaggcgggacgattctgggcacttcccgccagccattcaaggaa
atgcgggtcatcgttgacggctttgacaaggtagccgccatgaagaagacctacaagaag
ctcaacctggacgctttggcggttttgggcggcaacgggtcacttaagtcagccaacatg
ctggcccaagaaggcttgaacgtgattggcctgccaaagaccatcgacaacgacacttgg
gggactgactacaccttcggtttccaaagcgccattgatattgccaccagatacctggat
gacatccacactactgctcaaagccactcccgggtctttgtcgtcgaagtcatgggccac
aaggttggccacatcaccctggccgccggcctggctgccggcagcgacattatcctttta
ccggaaatcccttatgacatcaatgtcgtggccaagaaggtcaaggaaagacaaaagtct
ggcaagggcttcacggtcattgccgccgctgaaggggcaatttccaaggaagacgccacc
ctgtccaagaagaagtacaaggctaaggttgccgctagaaacggcgccagcgtggttaac
gaaatcgctgcccaattgcaggaagttttgccagacgctgaaatcagaacggcggtcatc
ggccacgctcaacggggcggccggccagatgcctacgaccggcaaatctcaacccgcttc
gggattgaaggggcccgcctgatcatgaaccggtccttcggccgcctggttgtcttgaag
caaggcgaagtcgactctatcgccctggaagacacggccggcaagctcaagtacgttgac
ccgaacggcaagaccgtaagcaacgcccgccttatgggagtcacctttggggacaagtaa

DBGET integrated database retrieval system