KEGG   Leishmania donovani: LDBPK_010510Help
Entry
LDBPK_010510      CDS       T02289                                 

Definition
(RefSeq) long chain fatty acid CoA ligase, putative
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ldo  Leishmania donovani
Pathway
ldo00061  Fatty acid biosynthesis
ldo00071  Fatty acid degradation
ldo01100  Metabolic pathways
ldo01212  Fatty acid metabolism
ldo04146  Peroxisome
Module
ldo_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ldo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LDBPK_010510
   00071 Fatty acid degradation
    LDBPK_010510
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    LDBPK_010510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ldo01004]
    LDBPK_010510
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ldo04147]
    LDBPK_010510
Enzymes [BR:ldo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     LDBPK_010510
Lipid biosynthesis proteins [BR:ldo01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   LDBPK_010510
Exosome [BR:ldo04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   LDBPK_010510
  Exosomal proteins of breast cancer cells
   LDBPK_010510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 13389783
NCBI-ProteinID: XP_003857864
UniProt: E9B7B5 A0A451EJA5
Position
1:134257..136353
Genome map
AA seq 698 aa AA seqDB search
MGGCVVSLMECKARSDEVPWEFSEDVKSYGPLSVAVAGTQTPNSSAVYVNGKRSTLAEQQ
ECAKRFYYGPNQTQRFARLCQENLDDVALAYRRIEKMEKEQVAGASRPMDVAYFSAQCDL
TYRELWHAVTGFSRGLAELGLEKRANVTIYEETRWEWLASIYGIWMQDMVAATVYANLGE
DALFYALRETECEAILCNGKNVPNLLRGVGSGAFPACTLIYLDNLPAAGCAELHGCRVLS
WEDVVALGHGAGAHHGAAPPEDNESVALIMYTSGTTGDPKGVMHTHGSIVAGILTMDDWL
YSVIKHRPDDVYLSYLPLAHIMEFGVVNILLARRAHVAFGTPRTLTDATARPHGDFTQFR
PTLLIGVPRIFDTLKKAVEAKLPPVGTLKRQVFDHAYQSRLAALKEGKDTPYWNEKVFSL
PRAALGGRVRAFLSGGGPLSESTQEFVNVVFGCIVNGWGLTETVCIGAIQRLGDLTPSAV
GQVLCSEQLKLLDIDEYKHTDTPEPRGEICLRGPFLFKGYYKQPELTREVLDEDGWFHTG
DVGSIDSEGRVSIVGRVKALAKNCLGEYIALEVLEAIYSSHPLVLNNCVCVLVDPCKNYI
CALVLTDEGRVTRFAKANRIEGEYPALLEKKELLEKAAASMAETARAARRRDFELVRRVS
LIDDEWSPEKGQLTAALKLRRGAVAKQYEKQIACLFAE
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgggcggttgtgtcgtgtcgctgatggagtgcaaggcccgcagcgacgaggtgccgtgg
gagttctccgaggacgtgaagagctacggccccttgagcgtggcagtcgcaggcacgcaa
acccccaacagctccgccgtgtacgtgaacggcaagcggtccacgctggcggaacagcag
gagtgtgcgaagaggttctactacggccctaaccagacgcagcgttttgcgaggctatgc
caggagaacctcgatgacgtggctctggcgtaccgccgcatcgagaagatggaaaaggag
caggtggcgggcgcatcgcggccgatggacgtcgcgtacttctccgcgcaatgtgacctc
acgtaccgggagctgtggcacgccgtgaccggcttcagccgcggcctcgccgagctcggg
ctcgagaaacgcgccaacgtgaccatctacgaggaaacgcgctgggagtggctggcgtct
atctacggcatctggatgcaggacatggtcgccgccaccgtctacgccaacctcggcgag
gacgctctcttctacgcactgcgcgagacagagtgcgaggcgattctgtgcaacggcaag
aacgtgccgaatctgctgcgcggcgtcggcagcggtgccttccctgcgtgcacgctcatc
tacttggacaatctgccggcggcagggtgcgcggagctgcacgggtgccgcgtgttgtcg
tgggaggacgtggtggcgctgggccacggcgcgggtgcgcaccacggcgccgcgccaccg
gaggacaacgaatcagtggcactgatcatgtacacgagcggcacgaccggtgacccgaag
ggcgtcatgcacacgcacggcagcatcgtcgccggtatcctcaccatggacgactggctc
tacagcgtcatcaagcacagaccggatgatgtctacctctcctacctaccactggcgcac
atcatggagttcggtgtggtgaacatcctcctcgcccgccgcgcccacgtcgcgttcggc
acgccgcgcacgctgacggacgccacggcgcggccgcacggcgactttacccagttccgc
ccaacgctgctcatcggcgtgccgcgcatcttcgacacgctcaagaaggccgtcgaggcg
aagctgccgccggtgggcacgctcaagcgacaggtgttcgaccacgcctaccagagccgg
ctggcggcgctgaaggagggcaaggacacgccgtactggaacgagaaggtgttcagtctg
ccacgcgcggctctgggaggtcgcgtgcgcgcctttctcagcggcggcggcccactctcc
gagtccacgcaggagttcgtgaacgtggtttttgggtgcatcgtcaacggctggggcctc
acggagacggtgtgcatcggtgccattcaacggctgggtgacctgacgccgtctgccgta
ggccaggtgctctgttcggagcagctgaagctgctcgacattgacgagtacaagcacacg
gacacgcccgagccgcgcggcgagatctgcctgcgcggcccgttccttttcaagggctac
tacaagcagccggagctgacgcgcgaggtgctggacgaggatggctggttccacaccggc
gacgttggcagcatcgacagcgaaggtcgcgtctccatagtggggcgcgtcaaggcgctg
gcgaagaactgcctgggcgagtacatcgcgctggaggtgctcgaagccatctacagcagc
cacccgctggtcctgaacaactgtgtatgtgtgttggtggacccgtgcaagaactacatc
tgcgccctcgtgctcacagacgagggccgcgtgacgcgcttcgcgaaggcgaacaggatc
gagggcgagtacccggccctactagagaagaaggagctgctggagaaagccgccgcgtcg
atggcggagacggcccgcgcggcgcggcgccgcgacttcgagcttgtgcgccgtgtttcc
cttatcgatgacgagtggtcgccggagaagggtcagctaacggcggcgctgaagctaagg
cgcggcgctgtcgctaagcagtatgaaaaacaaatcgcatgcttgttcgcggagtga

DBGET integrated database retrieval system