KEGG   Leishmania donovani: LDBPK_091410Help
Entry
LDBPK_091410      CDS       T02289                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
ldo  Leishmania donovani
Brite
Chromosome and associated proteins [BR:ldo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    LDBPK_091410
Exosome [BR:ldo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LDBPK_091410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF GMP_synt_C
Motif
Other DBs
NCBI-GeneID: 13392167
NCBI-ProteinID: XP_003858819
UniProt: A0A0R4J6X0 Q4JHM7
Position
9:complement(533735..534070)
Genome map
AA seq 111 aa AA seqDB search
MASSRSAPRKASNPHKSHRKPKRTWNVYVGRSLKAINAQMSMSHRTMKIVNSYVNDVMER
ICTEAASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEGTKAVSSASR
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttctcgctctgctccccgcaaggcttccaacccgcacaagtcgcaccgtaag
cctaagcgcacgtggaacgtgtacgtgggccgctcgctgaaggcgatcaacgcccagatg
tcgatgtcgcaccgcacgatgaagatcgtgaactcgtacgtgaacgacgtgatggagcgc
atctgcactgaggccgcgtcgattgttcgcgcgaacaagaagcgcacgctgggtgcgcgc
gaggtgcagacggcggtgcgtattgtgctgccggcggagctcgcgaagcacgccatggct
gagggcacgaaggccgtgtcgagcgcgtcgcgttga

DBGET integrated database retrieval system