KEGG   Leishmania donovani: LDBPK_191460Help
Entry
LDBPK_191460      CDS       T02289                                 

Definition
(RefSeq) cysteine peptidase A (CBA)
Organism
ldo  Leishmania donovani
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 13386130
NCBI-ProteinID: XP_003860318
UniProt: Q9BIE1 E9BED5
Position
19:626399..627463
Genome map
AA seq 354 aa AA seqDB search
MARRNPFFFAIVVTILFVVCYGSALIAQTPLGVDDFIASAHYGRFKKRHGKPFGEDAEEG
RRFNAFKQNMQTAYFLNAHNPHAHYDVSGKFADLTPQEFAKLYLNPNYYARHGKDYKEHV
HVDDSVRSGVMSVDWREKGVVTPVKNQGMCGSCWAFATTGNIEGQWALKNHSLVSLSEQV
LVSCDNIDDGCNGGLMEQAMQWIINDHNGTVPTEDSYPYTSAGGTRPPCHDNGTVGAKIA
GYMSLPHDEEEIAAYVGKNGPVAVAVDATTWQLYFGGVVTLCFGLSLNHGVLVVGFNRQA
KPPYWIVKNSWGSSWGEKGYIRLAMGSNQCLLKNYAVTATIDDSNTSHVPTTAA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgccgcaacccctttttttttgcgatagtggtaactatcctgttcgtggtgtgc
tacggttccgctcttatcgcccagacacctctcggcgtcgacgacttcattgcctcggcg
cattacggacgctttaagaagcgccacggcaagcccttcggcgaggacgccgaggagggt
cgacgcttcaacgccttcaagcagaacatgcagacagcctacttcctcaatgcgcacaac
ccgcacgcgcactacgacgtgtccggcaagttcgcggacctcaccccgcaggagttcgcc
aagttgtacctgaaccccaactactacgcgcgccacggcaaggattacaaggagcacgtg
cacgtcgacgacagcgtccgcagtggtgtgatgtcggtggactggcgtgagaagggtgtc
gtgacgccggtgaagaaccagggaatgtgcggctcgtgctgggccttcgccaccactggc
aacatcgaaggccagtgggctttaaaaaaccactcgctggtttcgctgtcggagcaagtc
ctcgtgtcgtgtgacaacatcgatgatgggtgcaacggcgggctgatggaacaggcaatg
caatggatcatcaacgatcacaacggcactgtgcccacggaggacagctacccctacacc
tctgccggcggcacgaggcctccgtgccatgacaacggcaccgtcggcgccaaaatagca
ggttacatgtccctgccgcatgacgaggaagagatcgcggcttatgtagggaagaacggc
ccagtcgccgtcgccgtcgacgcgacaacctggcagctgtactttggcggtgtggtcacc
ctctgcttcgggttgtcgctcaaccacggtgtgctcgttgtcggcttcaacagacaagca
aaaccgccgtactggatcgtgaagaactcgtggggctcctcgtggggtgagaaggggtac
atccgccttgccatgggcagcaaccagtgcttgctgaagaattacgccgtgacggccacg
attgacgactccaacacctcacacgtgccgacgacagcggcctag

DBGET integrated database retrieval system