KEGG   Leishmania donovani: LDBPK_210890Help
Entry
LDBPK_210890      CDS       T02289                                 

Definition
(RefSeq) methionyl-tRNA synthetase, putative
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ldo  Leishmania donovani
Pathway
ldo00450  Selenocompound metabolism
ldo00970  Aminoacyl-tRNA biosynthesis
ldo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LDBPK_210890
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LDBPK_210890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ldo01007]
    LDBPK_210890
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ldo03016]
    LDBPK_210890
Enzymes [BR:ldo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LDBPK_210890
Amino acid related enzymes [BR:ldo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LDBPK_210890
Transfer RNA biogenesis [BR:ldo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LDBPK_210890
 Prokaryotic type
   Other AARSs
    LDBPK_210890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 13386419
NCBI-ProteinID: XP_003860606
UniProt: A0A504XLV2 E9BF75
Position
21:265496..267739
Genome map
AA seq 747 aa AA seqDB search
MLKFFTEKANHQALKAVLCAVFVQKPLEVTLGSTYSTPYLQLPKSRALLYSCNEAARLLW
NTHAAPSPADNSLEGEAEWLEWESTVLTPALTPLYTQRRITGEAEVALKKLDSTIEEHQG
TVAVKGAPSSTSFLVDSVLFASLLPALCEGGLLPAAQAARVPHLVKWFQVFQAEHAELIA
SAFDVLSVQECSDFLRVPQTYEVSPKKQKVFFATTPIYYVNASPHIGHVYSTLIVDVLGR
YHRVKGEEVFVMTGTDEHGQKVAEAAAKQGVSPMDFTTSVSSEFKECFKEMNYDMNYFIR
TTNPTHEKLVQDIWKKLEAKGDIYLGKYEGWYSVSDESFLTAQNVADGVDKDGKPCKVSL
ESGHVVTWVEEENYMFRLSAFRERLLKYFHDHPNCIVPEFRRREVIKTVEKGLFDLSISR
KRESVMNWSIPVPGDERHCIYVWLDALFNYYTGALTRVAADGTETLDEDHHTLNRWPADV
HVVGKDILKFHAIYWPAFLMSAELPLPERLVSHGWWTKDRRKISKSLGNAFDPVEKAKEF
GIDALKYFLMRESNFQDDGDYSDKNMVARLNGELADTLGNLVSRCVAPKINVNGMWPEPA
EYSESDKTLIASLNNLAGTVDHYYCLPDIQHALIAIFDVLRSLNAYVTENAPWKLVKTDT
ARLGTVLYVTMEGLRICTMFLQPVMPQKAKEIMDALGVPEAARVDMENYLFGIVKPRTKI
AGLAEGQVIFQKVTLPTEEGERIPEGQ
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagttttttacagagaaggcgaatcatcaggccctcaaggccgtgctttgcgcc
gtgtttgtgcagaagcccctcgaggtgacgctgggcagcacctacagcacgccgtatctt
cagctgcccaagtccagggcgcttctgtacagctgcaatgaggcggcgcgtcttctctgg
aacacgcacgctgcgccgtcgcccgccgacaactcgctcgaaggagaggcggaatggctc
gagtgggagtcgacggtgctgacgccagccttgacccccctctacacgcagcgacgcatc
acgggcgaggctgaggttgccctgaagaagctcgactccaccatcgaggagcaccagggc
accgtggcggtgaagggggcgccgtcgtccacgtctttcttagtcgacagtgtcctcttc
gcgtccctcctgccggctctgtgcgagggtgggctgctccccgccgcgcaggcggcgagg
gtgccgcatttggtgaagtggttccaggttttccaggcggagcacgcggagctgattgcc
tctgcgtttgacgtgctgtcggtgcaagagtgcagcgacttcttgcgggtgccgcagacg
tacgaggtgagccccaagaagcagaaagtcttcttcgccacgacgccgatctactacgtg
aacgcgtcgccacacatcggccacgtctacagcacgctcatcgtcgacgttctcggccgt
tatcaccgagtgaagggagaggaggtgtttgtgatgacgggcacggacgagcacggccag
aaggtggccgaggcagcggcgaagcagggggtatcgccgatggacttcacaacgagcgtg
tcgagcgagtttaaggagtgtttcaaggagatgaattatgacatgaactacttcatccgc
acgacgaacccgacgcatgagaagctggtgcaggacatctggaagaagctggaggcgaag
ggcgacatctacctcggcaagtacgagggctggtactcggtgagcgacgagtcattcctg
acggcgcagaacgtggcggacggtgtagacaaggatggaaagccgtgcaaggttagcctg
gagagcggccacgtcgtgacgtgggtggaggaggagaactacatgttccgtcttagcgcg
ttccgcgagcgtctcctcaagtacttccatgaccatcccaactgcatcgtcccggagttc
cgccgccgcgaggtgatcaagacagtcgagaagggtctcttcgacttgtccatctcccgc
aagcgcgagtccgtcatgaactggtccatcccggtccccggtgatgagcgccactgcatc
tacgtgtggctggatgccctcttcaactactacaccggcgccctgacccgtgtcgcagcc
gacggcaccgagacactggacgaggaccaccacacactgaaccggtggccggccgacgtg
cacgtggtcggcaaggacatcctcaagtttcatgccatttactggccagccttcctgatg
tccgcggaactgccgctgccggagcggctggtgtcgcatggctggtggacaaaagatcgc
aggaagatcagcaagtcgctcggcaacgccttcgacccagtggaaaaggcgaaagagttc
ggcatcgacgcgctcaaatacttcctgatgcgcgagtcgaacttccaggatgatggcgat
tacagtgacaagaacatggtggcccgcctgaatggcgaactcgccgacacgctcggcaac
ttggtgtcgcgctgtgtggcgccgaagatcaatgtgaacggtatgtggccggaacccgca
gagtacagcgagagcgacaagacgctgatcgcctcgctcaacaacctggctggcacggtg
gaccactattactgcctgcctgacattcagcacgcgttgattgccatctttgacgtgctc
cgcagcctcaacgcctatgtgactgagaacgcaccgtggaagctggtgaaaacggacacg
gcgcgtctcggcacagtgctgtatgtaacgatggagggtctgcgcatctgcaccatgttc
ctgcagccggtgatgccgcagaaggcgaaggagattatggacgcgctcggggtgccggag
gcggcgcgcgtggacatggaaaactacctattcggcattgtaaagccgagaacgaagatt
gctggcttggcggagggccaggtcatcttccagaaggtgacactccccactgaggagggg
gagcgcattcccgaaggacagtaa

DBGET integrated database retrieval system