KEGG   Leishmania donovani: LDBPK_231070Help
Entry
LDBPK_231070      CDS       T02289                                 

Definition
(RefSeq) beta-fructosidase-like protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ldo  Leishmania donovani
Pathway
ldo00052  Galactose metabolism
ldo00500  Starch and sucrose metabolism
ldo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LDBPK_231070
   00500 Starch and sucrose metabolism
    LDBPK_231070
Enzymes [BR:ldo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LDBPK_231070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 13390204
NCBI-ProteinID: XP_003861005
UniProt: E9BGC5
Position
23:complement(<446117..446659)
Genome map
AA seq 181 aa AA seqDB search
MSSQAQQRAPAYAPRGTHAERLAAADREAAARWDSSTNCTWYPDYHLAPHTGWMNDPTGL
VHFRDHYHVFYQYHPYSAEWGPMHWGHVTSEDLVHWQHEKAALAPGDACDRDGCFSGTAV
VHDDRMYVFYTGHFVLEAATPSNPDAIFEQQCVAVSSDGVNFEKLGAVVRPPPGYVHFRD
P
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagctctcaagcgcagcagcgcgcgccggcctacgctccgcgcggcacccatgccgag
cggctcgcggccgcggaccgggaggccgctgcccgatgggactcctcgacgaactgcaca
tggtatcccgactaccaccttgcaccgcacacggggtggatgaacgacccaacggggctg
gtgcacttccgcgatcactaccacgttttttaccagtaccacccgtacagtgccgagtgg
ggtccaatgcactggggccacgtgacgagcgaggatcttgtgcactggcagcacgaaaag
gcggcgctggcaccaggagacgcgtgtgatcgcgacggctgcttctctggcaccgccgtc
gtgcacgacgacaggatgtacgtcttctatacgggccacttcgtgcttgaggcggcgacg
ccaagcaacccggacgccatctttgagcagcagtgcgtcgccgtcagcagcgacggcgtg
aacttcgagaagctcggcgccgtcgtgcgcccgccaccggggtacgtgcacttccgtgac
ccg

DBGET integrated database retrieval system