KEGG   Leishmania donovani: LDBPK_281390Help
Entry
LDBPK_281390      CDS       T02289                                 

Definition
(RefSeq) phenylalanine-4-hydroxylase, putative
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
ldo  Leishmania donovani
Pathway
ldo00360  Phenylalanine metabolism
ldo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ldo00790  Folate biosynthesis
ldo01100  Metabolic pathways
ldo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ldo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    LDBPK_281390
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LDBPK_281390
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LDBPK_281390
Enzymes [BR:ldo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     LDBPK_281390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-GeneID: 13386974
NCBI-ProteinID: XP_003862238
UniProt: E9BJL0 A0A3S5H7J2
Position
28:488284..489642
Genome map
AA seq 452 aa AA seqDB search
MLLRSRLFLEAGMAAAATLKDQYASSGSNIKGADKKTRCRTSLQVSLSTDKPGELCHLLS
VFKPYSINISQVANRPRAYENKAPLRTIFLDVDAYIEDESMKKVMTELHAKFPNVVVAGS
WVIPWYPTEPKDLDELDQSTLAAGEELQEDPENPHPGFHDEVYRARRREIVGLAKNYKTG
DQIPIVNYTEEENRVWTVVYDHLTRLYPTHACQQYNYVFPLLLENGVLSRTQTPQLRDVS
EFLNEATGFTVRPVTGLLTSRDFLNALAFRVFYSTQYIRHAAQPLYTPEPDMVHDIIGHL
PLLSDPDFANFTQTIGLASLGASDELLDKLAKVYWYSVEFGLCSEGGRRKAYGAGILSSC
GELEYALSDKPECVPWDPTMASKTPFPITKYQPRYFVAESFSDAQRKLETWLSSQEKPLY
TVYNSYSRRVQSYPKNTWNMLQEQMKRTNFTF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgcgcagtcgtttgttcctggaggctggcatggccgccgccgccaccctgaag
gaccagtacgcctcctccgggagcaacatcaagggcgccgacaagaagacgcggtgccgc
acgtccctgcaggtgtccctctccactgataagcctggcgagctgtgtcacctgctgagc
gtcttcaagccgtacagcatcaacatcagccaggtcgccaaccgtcctcgcgcgtacgaa
aacaaggcgccgctgcgcaccatcttcctcgacgtggacgcttacattgaggacgaaagc
atgaagaaggtcatgacggagctgcacgcgaaatttccgaatgtagtcgtagccggatca
tgggtgattccgtggtatccgacggagcccaaagacctcgacgaactcgatcagagcacg
ctcgctgctggcgaggagctgcaagaagacccggaaaacccccaccccggcttccacgac
gaggtctaccgcgcccgccgccgcgagattgtcgggcttgccaagaactacaaaaccgga
gatcagatcccgattgtaaactacacagaagaagagaaccgtgtgtggacagttgtctac
gaccacctgacccgcctgtacccgacgcacgcgtgccaacagtacaactacgtcttcccg
ctgctcctcgaaaacggtgtgctgagccgcacacaaacgccacagctgcgcgatgtgagc
gagttcctgaacgaggcgaccggtttcacggtacgcccggtgacggggctgctgacgtcg
cgcgacttcttgaacgccctggcgttccgcgtcttttacagcacccagtacattcgccac
gcggctcagccgttgtacacgccggagccggacatggtgcatgacatcattggtcacctg
cccctgctctctgatcccgacttcgccaacttcacccagacgatcggcctcgcctccctt
ggcgccagcgatgagctgctggacaagctggcaaaggtctactggtatagcgtcgagttc
ggcctctgcagcgagggcggccgccgcaaggcctacggtgctggtattttatcgagctgt
ggcgagctagagtacgcactgagcgacaagccggagtgcgtcccgtgggaccccacaatg
gcgtccaaaacgccgttccccatcaccaagtaccagccgcggtactttgtggctgaaagc
ttctcagatgcgcagcgtaagctggagacgtggctcagctcgcaggagaagccgctgtac
accgtctacaactcgtactcgcggcgcgtgcagtcgtacccgaagaacacgtggaacatg
ctccaagagcagatgaagcgaacaaacttcaccttctaa

DBGET integrated database retrieval system