KEGG   Leishmania donovani: LDBPK_282760Help
Entry
LDBPK_282760      CDS       T02289                                 

Definition
(RefSeq) 40S ribosomal protein S17, putative
  KO
K02962  small subunit ribosomal protein S17e
Organism
ldo  Leishmania donovani
Pathway
ldo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ldo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LDBPK_282760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ldo03011]
    LDBPK_282760
Ribosome [BR:ldo03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    LDBPK_282760
  Archaea
    LDBPK_282760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S17e
Motif
Other DBs
NCBI-GeneID: 13387110
NCBI-ProteinID: XP_003862374
UniProt: E9BJZ5 A0A3Q8IQV8
Structure
PDB: 

Position
28:1017634..>1018062
Genome map
AA seq 143 aa AA seqDB search
MGKIRTKTVKRASRQVVEKYYSKLNFDFYQNKRVIMDVTIAESKKLKNKIAGYTTHIMKR
LARGPVRGISLKLQEEERERRMDHAPATSDVDKAIQSGVSVDKRTMQMLQRLEIGVPRRV
KRADAAVAKVKAAPRRRQQKSSK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaatccgcaccaagaccgtgaagcgtgcctcccgccaggtggtggagaagtac
tactcgaagctgaacttcgacttctaccagaacaagcgcgtcatcatggacgtgacgatt
gcggagtctaagaagctgaagaacaagatcgccgggtacacgactcacatcatgaagcgc
ctggcccgcggccccgtgcgcggcatctcgctgaagctgcaggaggaggagcgcgagcgc
cgcatggaccacgcccccgcgacgtccgacgtggacaaggcgatccagtctggcgtgagc
gtggacaagaggacgatgcagatgctgcagcgcctggagatcggcgtgccgcgccgcgtg
aagcgcgccgatgccgccgtggcgaaggtgaaggcggctccgcgccgccgccagcagaag
agctccaag

DBGET integrated database retrieval system