KEGG   Leishmania donovani: LDBPK_312410Help
Entry
LDBPK_312410      CDS       T02289                                 

Definition
(RefSeq) p-nitrophenylphosphatase, putative
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     LDBPK_312410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like PGP_phosphatase Hydrolase HAD_2
Motif
Other DBs
NCBI-GeneID: 13389661
NCBI-ProteinID: XP_003863329
UniProt: A0A3Q8IFQ8 E9BN12
Position
31:complement(1165515..1166756)
Genome map
AA seq 413 aa AA seqDB search
MKPASPPCAAVQASSLRSCFIPPHLSFPVTAPGPPYTDRNNVPRQILSAMPEQMTAALAA
RLVASPLKYVLLDIDGVIWCGGHVIDRVPETLQYLRGQGKQIRFLSNNASLSREQLLQSL
KAKGIEGVTMEECYNSAYTAALRLRQLLGKADVPGEEPLVHGNVFVIGEQGLHDELQQVL
APGFITYGVELHDAERAGGYDTDALGSAWRVPCLPPPQKRLVVCNGKTCRMVQAGTNSAE
KISLSDLNAAAVVVGLDKHFNILKLAYGSLALQGPPKDLREESHTPPLFVATNEDPQLPV
GRDGTMIPGAGSMVSALCTAVGKRPDAVCGKPHKDMANILFAAEGITNPREECIMIGDRL
TTDVAFGNAAGCQSMLVLSGVEGLADVEEAEKQGKTALMPKYVAESLACFLPS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggcaagtccgccgtgtgccgctgtgcaggcatcctctctgcgctcctgtttc
attcctccgcacctctccttccccgtcactgctccggggcctccctacaccgacagaaac
aacgtgccacgacagatcctttccgcgatgccagagcaaatgactgcagcgctggctgcg
cgactcgtggcctcgcctctgaagtacgtgctgctcgacattgacggcgtgatctggtgc
ggcgggcacgtgatcgaccgtgtgccagagacgctgcagtacctgcgcggccaaggcaag
caaatccgctttctctcgaacaacgcgtcgctttctcgcgagcagttgctgcagagcctc
aaggctaagggaatcgagggcgtgacaatggaagagtgctacaacagcgcgtacacggcg
gcgctgcgactgaggcagctgctgggtaaagcagacgtgcctggagaggagccgctggtg
cacgggaatgtgttcgtgattggtgagcaggggctgcacgatgagctgcagcaggtactt
gccccggggtttatcacttacggtgtggagctgcacgatgcggagcgcgctggaggctac
gacacggatgcgcttggcagcgcgtggcgtgttccgtgcctgccgccgccgcagaagcgc
ctggtggtgtgcaacggcaagacatgccgcatggtgcaggccggcaccaacagtgcggag
aagatttcgctctccgacctgaacgccgctgctgtcgtcgttgggcttgacaagcatttc
aacatcctcaagctggcgtacgggtcccttgctctgcaaggcccaccaaaggacctgcga
gaggagtcgcacacgccgcctctgttcgtggccacgaacgaggatccacagctgccggtc
ggtcgcgatggcaccatgatcccaggcgctggatccatggtgagcgctctgtgcaccgct
gtcggaaagcggccggatgccgtctgtgggaagcctcacaaggacatggcgaatatattg
tttgcggctgagggtatcacgaatccgcgagaggagtgcatcatgatcggtgaccggctg
accacggatgtggcgtttggcaatgcggccggatgccagagcatgctagtgctgagcggc
gtcgaagggttggcggatgtggaggaggcggagaagcaaggcaagacagcgctgatgcca
aagtacgttgccgagtctctcgcctgcttcttgccatcgtga

DBGET integrated database retrieval system