KEGG   Leishmania donovani: LDBPK_322470
Entry
LDBPK_322470      CDS       T02289                                 

Definition
(RefSeq) C-14 sterol reductase, putative
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ldo  Leishmania donovani
Pathway
ldo00100  Steroid biosynthesis
ldo01100  Metabolic pathways
ldo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ldo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    LDBPK_322470
Enzymes [BR:ldo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     LDBPK_322470
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 13390948
NCBI-ProteinID: XP_003863660
UniProt: A0A3S7X5R0 E9BNZ8
Position
32:complement(920033..921346)
AA seq 437 aa
MAKGRGAASKAEANPLQPRTKTYEWGGPVGALFMVAFLPTLVVALNSLCAAEQCSLMLAM
RMPALMKEVVQGAWPMLRTAIGIELAWIAAHAVFSILPIGKLVYGAELRSGERLAYRMNA
IHAFVVAHLVLFGLHFTSILNMAVVADLYHPLMIGAILISFAMSVVLYAASYRSRNVLTA
LGGNSGSVLYDFWVGRELNPRTGPLDWKLMCELRPGLIGWSILNWAFVCKSVELGTVTPS
IVLTALFESFYVLDGLLLEAGNLSMMDIVTDGFGFMLCFGDLAWVPFTYTLQTKYLVHHP
AHLSLVHLCLCVSLSAAGYLIFRNANTEKDRFRKNPQDPRVQHLRIMKTSKGKSLIISGY
WGVCRHPNYVGDWLMALGWAAFSGTAEWLPYFHPLYFGLLLMHRQLRDEQQMREKYGNED
WNAFCRVVKYRLFPYIY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcgaaaggcagaggagctgcttccaaggcagaggcgaatcctctgcagccccgcacg
aaaacctacgagtggggcggcccggtcggagccctcttcatggttgcctttctccctaca
ctggttgtagcgctgaatagcctgtgcgctgcggagcagtgcagcctcatgctggcaatg
cggatgcctgcactaatgaaggaggtggtgcagggcgcgtggccgatgctgcggacggcg
atcggcatcgagcttgcgtggatcgccgctcacgccgtattttccatcctccctattggc
aagctcgtctacggcgccgagctccgcagcggcgagcggcttgcctaccgcatgaacgcc
atccacgccttcgtcgtggctcacttagtgctctttggcctgcacttcacctccatcctc
aacatggctgttgtggccgacctctaccaccccctcatgatcggcgccattctcatctcg
ttcgccatgtcggtcgtgctatatgcggcgtcgtaccgcagccgcaacgtactcacggct
ctcggtggcaacagtgggagcgtcctgtacgacttttgggtcggccgcgagctgaacccg
cgcaccggtccgctggactggaagctgatgtgcgaactgcggcctggtctcattggctgg
agtattctcaactgggcattcgtgtgcaagtcggtcgagctgggtaccgtgacgccgagc
atcgtgctcaccgcacttttcgagtccttctacgtgctggacggcctgctgctggaggcg
ggaaacctcagcatgatggacattgtgacggacggctttggctttatgctgtgctttggt
gaccttgcatgggtgccgtttacgtacacgctgcagacaaagtatctcgtccaccacccc
gcgcacctctcgctcgtgcatctgtgcctctgcgtttccctttctgctgccggctacctt
atctttcgaaatgcgaacacagaaaaggaccgcttccgcaaaaatccgcaggacccgcgc
gtgcagcacctgcgcatcatgaagacctccaagggcaagtctctcatcatctccggctac
tggggcgtgtgccggcacccaaactacgttggtgactggctgatggcgctcggctgggcg
gcgttcagcggcacggcagagtggttgccgtactttcatcctctttactttggcctcctc
ctcatgcaccgtcagctgcgtgatgagcagcagatgcgagagaagtacggcaatgaggac
tggaacgcgttctgtcgcgtcgtcaagtatcggctgttcccgtacatatactag

DBGET integrated database retrieval system