KEGG   Leishmania donovani: LDBPK_362160
Entry
LDBPK_362160      CDS       T02289                                 

Definition
(RefSeq) alpha-1,3-mannosyltransferase, putative
  KO
K03845  alpha-1,3-mannosyltransferase [EC:2.4.1.258]
Organism
ldo  Leishmania donovani
Pathway
ldo00510  N-Glycan biosynthesis
ldo00513  Various types of N-glycan biosynthesis
ldo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    LDBPK_362160
   00513 Various types of N-glycan biosynthesis
    LDBPK_362160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ldo01003]
    LDBPK_362160
Enzymes [BR:ldo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.258  dolichyl-P-Man:Man5GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     LDBPK_362160
Glycosyltransferases [BR:ldo01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   LDBPK_362160
SSDB
Motif
Pfam: ALG3
Other DBs
NCBI-GeneID: 13388217
NCBI-ProteinID: XP_003865331
UniProt: A0A3S7XAS6 E9BTS5
Position
36:818114..819457
AA seq 447 aa
MKFMDVALAAEAVVIITVILTVPYTEIDWKAYMEEVEGFLAGELDYRNLKGGTGPLVYPG
GFVWVYSALYYLTKKGEAIELAQWIYAGVYLVTLTMILRLYTRSGHTWQTMIPLFVSKRI
RSLYVLRLFNDCWAMLFLFAAVSFIAGRPSGAAKRSRQWLIGCLCYSIAVSIKMNVLLFA
PGMLYVMLRTLPFWRVAWYLLVCAAWQVAAGLPFLAYDHRAYLSKSFELDRVFLQRWSVN
YQFLNSELFAKPEFGQALLAMTVATWVLLWRTRWAARTYLTDAEVHVSHPAISDTRRQNT
LLRRGAADGDKTMDNEAQEQAVYASTLLTFFEANLVGVIFARSIHYQFYTWFFYTVPFVL
AYTTFPRVLRLVSFALIRQGFESFPPTPKTSMMLQGGFALMLFAILFMGREARPAATREE
THPARDNEPKLPQTQGTAGATGEKKIR
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgaagttcatggacgtagcgctggccgcagaggcggtcgtcatcatcaccgtcatcctc
acagtgccctacacggagatcgactggaaggcgtacatggaggaggtggaggggtttctt
gctggcgagctggactaccgcaaccttaagggcggcaccgggccactggtctacccgggc
ggctttgtgtgggtgtacagtgccctctactatctcaccaagaagggtgaggccattgag
ctggcccagtggatatacgccggcgtctaccttgtgaccttgacaatgatcttgcgcctc
tacacccgctccgggcacacgtggcaaaccatgataccgctcttcgtctccaagcgcatt
cgcagcctctacgtgctgcgacttttcaacgactgctgggctatgctgttcctgttcgct
gccgtctccttcatcgctggccgccccagcggcgccgccaagcgctcgcgtcagtggctc
attgggtgcctctgctactctatcgccgtgtccatcaagatgaacgtgctcctcttcgcg
ccaggcatgctttacgtgatgctccgcacactccctttctggcgagtcgcgtggtacctg
cttgtctgtgcggcgtggcaagtggccgcaggcttgccttttctggcctacgaccatagg
gcctacttatcgaagagctttgagcttgatcgcgtctttctgcagcggtggtcggtaaac
tatcaattcctcaattccgaactttttgctaagcctgagtttggccaggcgctgctcgcg
atgacagttgcaacgtgggttttgctgtggcgcacgcgctgggccgcacgcacctacttg
acggatgcggaggtgcatgtatcgcatccggcaatttccgatacgcgtcggcagaacacg
ctcttgcgccgcggcgctgccgacggtgacaagacgatggacaacgaggcacaggagcag
gcagtatacgcgtccacactgctcactttcttcgaggccaaccttgtcggcgtcatattt
gcccgctccattcattaccagttctacacgtggttcttctacactgttccctttgttctc
gcctacacgacgttcccacgggtgctgcggcttgtgagctttgccctcatccgccagggg
ttcgagtcgttcccaccgacgccgaagacgtcgatgatgctacaaggtggctttgccttg
atgctgtttgcgatcctctttatgggccgtgaagctcgtccagctgccacgcgggaggaa
acgcatccggcccgggacaatgaaccaaagttgccacaaacacaggggacagctggcgca
acaggcgagaagaaaatacggtga

DBGET integrated database retrieval system