KEGG   Leishmania donovani: LDBPK_362450Help
Entry
LDBPK_362450      CDS       T02289                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ldo  Leishmania donovani
Pathway
ldo00010  Glycolysis / Gluconeogenesis
ldo00052  Galactose metabolism
ldo00500  Starch and sucrose metabolism
ldo00520  Amino sugar and nucleotide sugar metabolism
ldo00524  Neomycin, kanamycin and gentamicin biosynthesis
ldo01100  Metabolic pathways
ldo01110  Biosynthesis of secondary metabolites
ldo01130  Biosynthesis of antibiotics
ldo01200  Carbon metabolism
Module
ldo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ldo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBPK_362450
   00052 Galactose metabolism
    LDBPK_362450
   00500 Starch and sucrose metabolism
    LDBPK_362450
   00520 Amino sugar and nucleotide sugar metabolism
    LDBPK_362450
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LDBPK_362450
Enzymes [BR:ldo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LDBPK_362450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-GeneID: 13388246
NCBI-ProteinID: XP_003865360
UniProt: E9BTV4
Position
36:938536..939771
Genome map
AA seq 411 aa AA seqDB search
MSLTDEIQLEQLAPTIKGDASWSTGPIYVVCDVGGTNARVGFAQAAQHDRSGLHIIYVRF
RVTKRDIRQLLEFFDEVLQHLKKNLPYRAGPFLRRVASGAVSVPGPVTNGQLAGPFNNLK
GTARLADYPVELFPKGRSALLNDLEAGSYGVLALSNAGMLSDYFKVMWKGTQWDALSEGK
PVGSTIGHGRCMVVAPGTGVGSSLIHYVGVSDSYVVLALECGCLSMSWCANEDSKYVQAL
AGYMASKARAKGLDSTVAPIWEAATNGSGLEFNYAYEKEGQKASVPLKSAPEVAKLAKAG
SDPAAVAAMDRLYKNLMGLTAETTMQFLPLTCVLMGDSIVSNSFYFDNPENVKRLQARIN
EHTMERQLKFLSRTTFLRQVRSVNINLLGCLGFGSQLSDPADQLAPNKSNL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcacagacgagatccaactcgagcagctggccccgaccatcaagggcgacgcc
tcctggtccaccggccccatctacgttgtgtgcgatgttggcggcacgaacgcgcgcgtc
ggctttgctcaagcggcgcagcacgatagaagcggcctgcacatcatctatgtccgcttc
agggtgacgaagcgcgacatccgccagctactcgagttcttcgatgaggtgctgcagcac
ctgaagaagaacctgccctaccgcgctggccccttcctgcgtcgtgtcgcgtccggtgcc
gtgagtgtgccgggacctgtcaccaacggacagctcgccggtcccttcaacaatctgaag
ggcactgcgcggctggcggactacccagtggagctgtttccaaagggccgcagcgcgctt
ctgaacgatctggaggctggctcctatggcgtgctggctctgagcaacgccggcatgctg
tccgactacttcaaggtcatgtggaagggcacgcagtgggacgcgctgtcggaaggcaag
cccgtcggcagcaccatcggccacggccgctgcatggtcgtggcccccggcaccggcgtc
ggctcctctctcatccactatgtgggtgtctcggacagctatgtcgtgctggcgctggag
tgcggctgtttgtccatgtcttggtgcgccaacgaggactcgaagtacgtgcaggcactt
gccggttacatggcgtccaaggcgcgtgcgaagggcctggactcgacggtggcccccatc
tgggaggctgcgacaaacggtagtgggttggagttcaactacgcgtacgagaaggagggg
cagaaggcatccgttcccctcaagtccgctcccgaggtagccaagctcgccaaggctggc
agcgacccggccgccgtggccgccatggaccgtctctacaagaacctcatgggcctcaca
gctgagacgacaatgcagttcctgccgctgacatgtgtgctgatgggcgacagcattgtt
tccaacagcttttacttcgataacccagagaatgtgaagaggctgcaggctcgcataaac
gagcacacgatggagcgtcagttaaagttcttgagtcgcaccacgttccttcgccaggtg
cgcagtgtgaatatcaacctgctgggctgccttggatttggtagccagctctccgacccg
gcagatcagttagcgccaaacaagtccaacttgtga

DBGET integrated database retrieval system