KEGG   Leuconostoc sp. C2: LGMK_01230Help
Entry
LGMK_01230        CDS       T01567                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lec  Leuconostoc sp. C2
Pathway
lec03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lec00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    LGMK_01230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lec03400]
    LGMK_01230
Enzymes [BR:lec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LGMK_01230
DNA repair and recombination proteins [BR:lec03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LGMK_01230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 Viral_helicase1 AAA_11 AAA_12 UvrD_C DUF2075 AAA AAA_16 AAA_22 HHH_5 TrwB_AAD_bind DUF815 AAA_28 RsgA_GTPase NTPase_1 Helicase_RecD AAA_5 AAA_29 T2SSE TsaE NACHT AAA_23 AAA_18
Motif
Other DBs
NCBI-ProteinID: AEJ30308
Position
260015..262402
Genome map
AA seq 795 aa AA seqDB search
MTYQEQQLEKITGTLQNVIFASSDSYFKILSVQIDDSTLENWDETEIIATGTFADVQEGS
VYAFYGSVVRHPKYGQQFKVTRYENELPPDENGLIKYFTSGQFSGIGKKTATKIVEHLGL
NAVNLILDDVHVLDGIVKEPTAKKLMRSLQLNLGLERLFQVGSQFGMGADMAGRLYDQYG
SEAETILNQDPYRLVFEFDGMSFRMADMIGQKIGINRTNERRVQAAVYATITTMSYQYGH
TYLTREKLIQSSVKLIRDFNAEVIVSQAIDHLLADKILVEEDQCLYAATLYLSEIQTAND
LNRLLDASLPFKLSEQAIDDAFITPGQLVLDKTQIAAVKAGLNAQVFLLTGGPGTGKTTI
VRAVVATWHKLLQAQAKYADNTTDFLKSYAVKMASPTGRAAKRMTEVTGYDATTIHRLLG
ISDLDEPEFNADNPITGGLLVVDEASMLDIELTAKLLAAIPNGMKLMIVGDSDQLPSVGP
GNVLADLVDSGKIAHIELDTIYRQGRGSSITTLAQHIKRGELPTDFMENQQDRSTFMVSH
DQTDQAIKQVVQAAVKKGYTQDDLQILTPIYKTTSGVNALNTMAQELFNPAKPAQKSLQF
GTTIFRKGDKILQLENDSERDIYNGDMGKIIAVQYKNDKSNNDHEDRLIVDFDGKEMSYP
KKDLNQLTLAYATTVHKAQGNEFKVVVMALTTRFGLMLNRNLLYTGITRAKEALILVGEY
EAFLHAAQTPVPMRSTRLKARLQNQVVVSSQVSVNSPNVEPKAARNHLTVEMIQSNDISP
LIGLNGITPYDFMPS
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaagaacaacaattagaaaaaatcactggtacgttacaaaatgttattttt
gcatcgtcagattcttattttaaaatattatcggttcaaattgacgattcaacgctcgaa
aattgggatgaaacggaaattattgcaacaggtacgtttgctgatgtacaagaaggcagt
gtttatgctttttatggttcggttgttcggcatccaaagtatgggcaacagtttaaagtc
acgcgttatgaaaatgagttaccgcctgatgaaaatggtctaattaagtattttacgagt
ggccaattttctggtattggtaagaaaacagcaactaaaattgttgagcatctgggcttg
aatgctgttaaccttattttagacgatgtacacgtgttggatggtattgttaaagagccc
acggccaagaaattaatgcgaagtctacaattgaatttaggactagagcgattatttcaa
gttggtagccagttcggcatgggtgcagatatggcaggtcgtttatacgatcagtatggt
agtgaagcagaaacaattttgaatcaagatccttatcgccttgtgtttgagtttgatggc
atgtcatttagaatggcagatatgattggtcaaaaaattggtattaatcgtacaaatgaa
cggcgtgtgcaggctgcagtttacgctacaataacaacaatgagctatcagtatggtcat
acttatcttacacgtgaaaaactgatacaatcaagtgtcaagttaattcgagatttcaat
gctgaagtgattgtgtcacaagctattgatcacttgttggcagataaaatcttggtagaa
gaagatcaatgcctttatgctgctacgctatatctttcggaaattcaaactgctaatgat
ttgaatcgcttgttagatgctagtttaccatttaaattgtcagagcaggctattgatgat
gcatttataacacctgggcaactcgtattagataagacgcagattgctgcagttaaagct
ggattaaatgcgcaagttttcctattgactggtggtccaggcactggtaagacaacaatt
gtacgcgctgttgttgcgacttggcataaattgttgcaagcgcaagcaaaatatgctgat
aatacaacagactttttaaagtcctatgctgtaaaaatggcatcaccaacagggcgcgcc
gccaagcgtatgacggaagtcacaggttacgacgcgaccacgattcaccggttgctcgga
atatcagatttagatgaaccagaatttaatgccgataatcctattacaggcggcttactg
gtcgttgatgaagcttcaatgcttgatattgaattaacagcgaaattactagcggctata
ccaaatggcatgaaactcatgatagttggtgactcagaccaactaccttcagttggtcca
gggaacgtcttagctgatcttgtggatagtggtaaaatagcgcatattgagcttgatacc
atttatcgtcagggcaggggcagcagtattacaacactagcccaacatattaagcgtggt
gaattaccaacagatttcatggaaaaccagcaagatcgatcaacttttatggtgtcacat
gaccaaactgatcaagcgattaaacaagtcgttcaagcagccgttaaaaagggttatacg
caggatgatctacaaatattgacacctatttacaagacaacatcaggtgttaatgcactt
aataccatggctcaagaacttttcaacccagctaagccagcccaaaaatcactccaattt
gggacaacgatttttcgcaagggtgataaaatattacaattagaaaatgatagtgagcgt
gatatttataatggtgatatgggtaaaattattgctgtccaatataaaaatgataaaagc
aacaatgatcatgaagatcgtctaattgtagattttgatgggaaagagatgagttaccca
aaaaaggatcttaatcaattaactttggcgtatgccacgaccgttcataaagcccaaggt
aatgaatttaaagtcgttgttatggccttaactactagatttggactgatgcttaatcgt
aatttattatacactggtatcactcgggctaaagaggctttgattttagttggcgaatat
gaagcgtttcttcatgccgcgcaaacgcctgtgccgatgcgttcaacaagattaaaggca
cgattacaaaatcaagtggttgtgtcatctcaagtaagtgttaatagcccgaatgtcgaa
cccaaagcagctaggaatcatttaacagttgaaatgattcaatcaaatgatatttcacca
ttgattggtttaaatggcatcacgccttacgattttatgccaagttaa

DBGET integrated database retrieval system