KEGG   Leuconostoc sp. C2: LGMK_03725Help
Entry
LGMK_03725        CDS       T01567                                 

Definition
(GenBank) D-alanine--D-alanyl carrier protein ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
lec  Leuconostoc sp. C2
Pathway
lec00473  D-Alanine metabolism
lec01100  Metabolic pathways
lec01503  Cationic antimicrobial peptide (CAMP) resistance
lec02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LGMK_03725
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LGMK_03725
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LGMK_03725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lec01504]
    LGMK_03725
Enzymes [BR:lec01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LGMK_03725
Antimicrobial resistance genes [BR:lec01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LGMK_03725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEJ30803
Position
complement(761019..762551)
Genome map
AA seq 510 aa AA seqDB search
MTIENIIEAIDTIGQRQGDTVAYDELGKTQTYAQLKTASDRLAAFITQAQITDKAPIMVY
GGQQVEMIVSFLGSAKSGHAYIPVDVNSASERLTDIIEIGKPALVIAVDDLPIEITQVPV
IDRTQLDGIFNTPSDFDMTKPVRGDDNFYIIFTSGTTGKPKGVQISHNNLLSFANWMLGE
DFGWGLGNNVLSQPPYSFDLSVMDWVPTLLSQGTLKALPKAAADDFKTLFKTLPGLHLNK
WVSTPSFADVALLDPEFTQENLPALNAFFFCGEVLTTTTAQKLIDRFPEAKIYNTYGPTE
ATVAVTGLPITKETIANNDKMPIGFVKSDTEIIIQDADGIVVADGQAGEIVIAGPSVSKG
YLNNPEKTAAAFTIVNGQNAYKTGDLALRDAGGLLHYKGRSDFQIKLHGFRIELEEVAQQ
LQQSQWVDQAVAVPRYDADGKVKQLIAILVAKSNHFEKPILLTNAIKADLQNIMMPYMIP
SRFMYRDALPLTANGKIDLKGLISEVNGHA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaaatatcatagaagcaatcgacacaattggtcaaagacaaggtgacaca
gttgcttatgatgaattgggaaaaacacaaacttatgcacagctcaaaacggcatcggat
cgtctagccgcttttataacacaggcacaaattactgataaagcaccaatcatggtttat
ggtgggcaacaagtcgaaatgattgttagcttcttaggtagtgctaaatcagggcacgcc
tatataccagttgatgttaattcagcatctgagcgcttgactgacattattgaaattggt
aagccggctttagtgattgccgtagatgatttgccaattgaaattacgcaagtgccagtc
attgaccggacacaacttgatggcatttttaacacaccatctgattttgatatgacaaaa
ccagttcgtggggatgataatttctatattatctttacatctggaacaacaggtaaacca
aaaggtgtgcaaatttcgcataataatctcttgagttttgctaattggatgttgggcgaa
gactttggctggggattaggcaacaatgttttgtcacaaccaccttattcgtttgacttg
tcagtgatggattgggtaccaacgctattatcacaagggacattaaaagcattaccaaaa
gcggctgctgatgattttaaaaccttatttaaaacattacctggcctccacttgaataag
tgggtatcgacaccatcttttgccgatgtggcgctacttgatccagaatttacgcaagaa
aatcttcctgctttgaatgcttttttcttttgtggcgaagttttgacgacaacaacagcg
caaaaactgattgatcgttttccagaagcaaaaatctataatacttatggtccaacagag
gcgactgttgcagtgactgggttgcctattacgaaagaaactattgcaaataacgacaaa
atgcctattggctttgtgaaatcggatactgaaatcattatacaagatgctgatggtatt
gtcgtagctgatggtcaagcgggtgaaattgtgattgctggtccgtctgtatccaaaggt
tatttaaacaatcctgagaaaacagcagcagcttttacaatagttaacgggcaaaatgct
tataaaacaggcgatttagctttacgtgatgctggtggtttattgcactataaaggacgc
agcgatttccaaatcaaattacacggattccgtattgaactagaagaggttgcccaacaa
ttgcaacaaagccaatgggttgaccaagcagttgctgtaccaaggtatgatgctgatggt
aaggtaaagcaactgatagccattctagtagctaaaagtaatcactttgagaagccgatt
ttattaacaaatgcaattaaagctgatcttcaaaacattatgatgccttatatgatacca
agtaggtttatgtacagagatgcgttgccactgaccgctaatggtaagattgatcttaaa
ggattgatttcagaggtaaatggtcatgcttaa

DBGET integrated database retrieval system