KEGG   Leuconostoc sp. C2: LGMK_03780Help
Entry
LGMK_03780        CDS       T01567                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lec  Leuconostoc sp. C2
Pathway
lec00040  Pentose and glucuronate interconversions
lec00052  Galactose metabolism
lec00500  Starch and sucrose metabolism
lec00520  Amino sugar and nucleotide sugar metabolism
lec01100  Metabolic pathways
lec01130  Biosynthesis of antibiotics
Module
lec_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LGMK_03780
   00052 Galactose metabolism
    LGMK_03780
   00500 Starch and sucrose metabolism
    LGMK_03780
   00520 Amino sugar and nucleotide sugar metabolism
    LGMK_03780
Enzymes [BR:lec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LGMK_03780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEJ30814
Position
complement(775324..776196)
Genome map
AA seq 290 aa AA seqDB search
MKPVRKAIIPAAGLGTRFLPATKALAKEMLPIVDTPTIEYIVREAIASGIEDIVIVDGKS
KRSIEDHFDSNPELENNLRDKGKDELLKIVQETTDINMYFIRQSHPKGLGDAVLTAKAFI
GDEPFVVLLGDDLMEDEVPLTKQLIQRYEETGESTLAVMKVPHDQVSEYGVIDPAAEASN
GLYRVKSFVEKPKPEDAPSDLAIIGRYLLTPEIFEELENTKPGKGNEIQLTDAIDSLNNR
QHVYAHQFKGNRYDIGSKIGFLETNIEFGLKHPQTKDQLRAYIKELAAKL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagtacgtaaagcaattattccagcagccggactaggcacacgtttcttgcca
gcaacaaaagcattggctaaagaaatgttaccaattgttgatacaccaacaatagaatac
atcgttcgtgaggccattgcttcgggaattgaggatattgtcattgttgatggcaaatca
aagcgatcaattgaagatcattttgattcaaatcctgagttggagaataacttgcgcgac
aagggtaaagatgagttgctcaagattgttcaggaaacgacggatattaatatgtatttt
attcgtcaatcacatcctaaaggtttaggagatgccgtgttaacggccaaagcctttatt
ggtgacgaaccatttgtggtgttactaggtgatgatttaatggaggacgaagtgccattg
acaaagcaactaatccaacgctatgaagagactggtgaatcaacattagctgttatgaaa
gtaccacatgatcaggtttctgaatatggcgtgattgatccggcagcagaagcttcaaat
ggcctataccgtgttaaatcatttgttgaaaagcctaagccagaagatgcgccatctgat
ttagcaattattgggcgttatttgttaacgcctgaaatatttgaagaattagaaaacaca
aagccaggcaagggtaatgaaatacaactaacagatgcgattgattcattgaataatcgt
caacatgtttatgcacatcaatttaaaggcaatcgttatgacatcggttcaaaaattggt
ttcttagaaacaaacattgagtttggtctgaagcacccacaaaccaaagatcaattacgc
gcctacattaaagaattagcagcaaaactttaa

DBGET integrated database retrieval system