KEGG   Leuconostoc sp. C2: LGMK_06345Help
Entry
LGMK_06345        CDS       T01567                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lec  Leuconostoc sp. C2
Pathway
lec00230  Purine metabolism
lec01100  Metabolic pathways
Module
lec_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LGMK_06345 (gmk)
Enzymes [BR:lec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LGMK_06345 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA MMR_HSR1 AAA_33 AAA_16 Rad17 AAA_22 cwf21 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEJ31323
Position
complement(1300687..1301283)
Genome map
AA seq 198 aa AA seqDB search
MTQRGLLIVLSGPSGVGKGTVRKAIFEEEGIDFQYSISATTRQPRVGEVDGEDYFFVSHE
AFEEKISNGDMLEYAQYVNNYYGTPKSFIDETLASGRDVFLEIDVQGALQVKSKMPEGVY
IFLTPPNLTNLRERLIGRGTDSQEIIEKRVTAARDELKQMINYDYAVENDRVVYAVDRIK
AIITAERLRVTRVFEKTL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcggggtttactgattgtgctgtctggcccttcaggagttgggaagggtaca
gtacgcaaagctatttttgaagaagagggtatcgactttcaatactcaatctcagctacg
actcgtcaaccacgtgttggcgaagtagacggtgaggattatttctttgtttcgcatgag
gcatttgaagaaaagatttcaaatggtgacatgttagaatatgcgcagtatgttaataat
tattatggtacgccaaaaagttttattgatgagactttagcgagtggtcgagatgtattt
cttgaaattgatgtgcaaggcgcattacaagtaaagtcaaaaatgcctgaaggggtttat
atttttttgacaccaccaaatttgacgaacctacgcgaaagattaattggccgtggcacg
gattcacaagaaattatcgaaaagcgtgtgacagctgcacgtgacgaattaaagcagatg
attaattatgattatgcagttgaaaatgatcgtgttgtctacgcagtggatcgtattaaa
gcaattattacagctgaacgtttacgtgttacacgtgtttttgaaaaaacactataa

DBGET integrated database retrieval system