KEGG   Lentzea guizhouensis: BBK82_08815Help
Entry
BBK82_08815       CDS       T04448                                 

Definition
(GenBank) bifunctional RNase H/acid phosphatase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
led  Lentzea guizhouensis
Pathway
led00860  Porphyrin and chlorophyll metabolism
led01100  Metabolic pathways
led03030  DNA replication
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBK82_08815
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BBK82_08815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:led03032]
    BBK82_08815
Enzymes [BR:led01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     BBK82_08815
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     BBK82_08815
DNA replication proteins [BR:led03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     BBK82_08815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: ANZ36152
UniProt: A0A1B2HEK9
Position
complement(1751837..1752946)
Genome map
AA seq 369 aa AA seqDB search
MKVIVEADGGSRGNPGPAGYGAVVRDHRTGETLAERKGFVGVATNNVAEYQGLIAGLKAA
GEVGAEVVEVRMDSKLVVEQMSGRWKIKHPSMQPLAKEAKQLADAFDKITYGWIPRERNR
QADRLANEAMDAQKESRRPDATEPDATKSDATAEGAKQPHWSGAVGEPTRLILLRHGQTR
LSVERRYSGRGDHPLTELGLEQASKAARRLSTVEDVAAVISSPLQRAAQTAQQVAQKLGL
DVVTHQGLIETDFGAWEGLTFAEAAQQDPDVHRRWLGDTSVRPPGGESFDEVHSRVRRAR
TELIAKYGGKTLVVVSHVTPIKTLLRQALDVGPQFLFRMHLDLTGVSIAEFYPDGHASVK
LVNDTSHLS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcatcgtcgaggccgacggagggtcgcggggcaatcctgggcctgccgggtac
ggggccgtggtccgcgatcatcggaccggggagacgctggccgagcggaaggggttcgtg
ggggttgcgactaacaacgtggccgagtaccaggggctgatcgcggggctgaaggcagcg
ggggaggtcggggccgaggtcgtcgaggtgcggatggactcgaagctggtcgtcgagcag
atgtcggggcgctggaagatcaagcacccgtcgatgcagccgctggcgaaggaggcgaag
cagctcgcggacgccttcgacaagatcacgtacgggtggattccgcgggagcgcaaccgg
caggcggaccggctcgccaacgaggccatggacgcccagaaagaaagccgccgaccggac
gcgacagaaccggacgcgacgaaatcggacgcgacggcagagggtgccaagcagccgcac
tggagtggggcggtgggggagcccacgcggctgatcttgctgaggcacgggcagaccagg
ctgagcgtcgaacgccgttactccggccgcggcgaccacccgctcaccgagctggggctg
gagcaggcgagcaaggccgctcgaaggctgtccactgtggaggacgtcgcggctgtcatc
tcatcgccgttgcagcgggccgctcagaccgcgcagcaggtcgcgcagaagctcggcctc
gacgtggtcacgcaccaggggttgatcgagacggacttcggcgcgtgggaggggctgacg
ttcgccgaggcggcgcagcaggaccccgacgtgcaccgcaggtggctgggcgacacgagt
gtgcggccgccgggcggtgagagcttcgacgaagtgcactcacgggtgcgtagggcgcgc
acggagctgattgccaagtacggcgggaagacgcttgtcgtggtgagtcatgtcacgccc
atcaagacgttgctgcgccaggcgttggacgtggggccgcagttcctgttccggatgcac
ctcgacctcacgggcgtctcgatcgccgagttctacccggacgggcacgcgtcggtgaag
ctggtcaacgacacatcgcacctgagctaa

DBGET integrated database retrieval system