KEGG   Lentzea guizhouensis: BBK82_19800Help
Entry
BBK82_19800       CDS       T04448                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
led  Lentzea guizhouensis
Pathway
led00270  Cysteine and methionine metabolism
led00920  Sulfur metabolism
led01100  Metabolic pathways
led01110  Biosynthesis of secondary metabolites
led01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BBK82_19800
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BBK82_19800
Enzymes [BR:led01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BBK82_19800
    2.3.1.46  homoserine O-succinyltransferase
     BBK82_19800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase
Motif
Other DBs
NCBI-ProteinID: ANZ37968
UniProt: A0A1B2HJQ7
Position
3941935..3942945
Genome map
AA seq 336 aa AA seqDB search
MTGWRFGDPNGRRKWFSHTEPFAGLPGFQLAYETWGTLNAEASNAVLVLHALTGDSHVAG
GVEPGHPTPGWWDALVEPGPLDGCFVVAPNVLGGCQGSTGPWQYPAFPALTIRDQVAAEA
LLADYLGIGRWAAVLGGSMGGMRAVEWAVSEPERVESLLLLATTAAASAEQIGLASAQLH
AIRADPREGLGVARRIAHISYRSEQELQARFGRQVQEDGRFEVESYLDHHAAKLSRRFDA
ASYVTLTEAMNSHDVGRGRGGVTAALGRVTARTLVAGVDSDRLYPLAQQRELAAGIPGAD
DLRVITSPYGHDAFLIETAQVGALVSELVPAHSGSR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggctggcgcttcggcgacccgaacgggcggcggaagtggttcagccacaccgag
ccgttcgccgggttgccgggtttccagctcgcgtacgagacgtgggggaccttgaacgcg
gaggcctccaacgcggtgctcgtgctccacgccctcaccggggacagccatgtcgccggg
ggcgtggagccgggtcaccccacgccgggctggtgggacgcgctcgtggagccgggaccg
ctggacgggtgtttcgtggtggcgcccaacgtgctcggcgggtgtcagggcagcaccggg
ccgtggcagtacccggcgttccccgcgctcaccatcagggatcaggttgcggcggaagca
cttctggccgactacctgggcatcgggcggtgggcggcggtgctcggcgggtcgatgggc
ggcatgcgcgcggtcgagtgggcggtgagcgagcccgagcgggtggagtcgttgctcctg
ctggccacgacggcggcggcgtcggcggagcagatcgggctggcgtcggcgcagctgcac
gcgatccgggccgatccacgcgaaggtctcggtgtggcgcggaggatcgcgcacatcagc
taccgcagcgagcaggagctgcaggcgcggttcgggcgtcaggtgcaggaggacggcagg
ttcgaggtcgagtcctatttggaccaccacgcggccaagctcagccggcggttcgacgcc
gccagctacgtcacgctcaccgaggcgatgaactcgcacgacgtggggcgcgggcggggt
ggggtcacggcggcgctgggcagggtgacggcgcggacgctggtggccggggtggactcg
gaccggctgtacccgttggcgcagcagcgggagctggccgcgggcattcccggtgccgac
gacctgcgggtgatcacctcgccgtacgggcacgacgcgttcctgatcgagaccgcgcag
gtcggggcgctcgtcagcgagctggtgcccgcgcactcaggtagtcgttga

DBGET integrated database retrieval system