KEGG   Lentzea guizhouensis: BBK82_28590Help
Entry
BBK82_28590       CDS       T04448                                 

Definition
(GenBank) hypothetical protein
  KO
K10187  germacradienol/geosmin synthase [EC:4.2.3.22 4.2.3.75 4.1.99.16]
Organism
led  Lentzea guizhouensis
Pathway
led00909  Sesquiterpenoid and triterpenoid biosynthesis
led01100  Metabolic pathways
led01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    BBK82_28590
Enzymes [BR:led01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.16  geosmin synthase
     BBK82_28590
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.22  germacradienol synthase
     BBK82_28590
    4.2.3.75  (-)-germacrene D synthase
     BBK82_28590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ANZ39417
UniProt: A0A1B2HNW2
Position
complement(5822497..5823495)
Genome map
AA seq 332 aa AA seqDB search
MGFEMPFAARLSPHVDRVRVHTRTWVRDMGMLGGTPWTEAFYDAADYGGFAALTHPTASL
DDLKHISDWHTWGFYLHDAFREGFLRPRNAMGGRTFVTRLKSVLADPSVPAMNPAEKGLA
DLLSRSTLDDGERAGIAGLLDGLLWELHNTVQGRVPDPIDLVEMRRTTNAAELSAALARR
SVGADLPEELLRNSTMKALVDSFGDVPGLRREVLGFDHLHGTGASTTSAVLAVQQFFECA
APQAVAVVGDLITARLRQIVSIIAELPSLADEYQLDETARAGLHRYAEALKSWLAGELLW
STRSGRFSSSPTPTGRSLHRPSGLGTAAVLVR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtggggttcgagatgcccttcgccgcccggctgtccccgcacgtcgaccgcgtccgcgta
cataccaggacgtgggtgcgcgacatgggaatgctcggcggcacgccgtggaccgaggcg
ttctacgacgcggcggactacggcgggttcgccgcgctcacccaccccacggcctcgctg
gacgacctcaagcacatcagcgactggcacacgtggggcttctacctgcacgacgcgttc
cgtgaggggttcctgcggccgcgcaacgcgatgggcggcaggacgttcgtcaccaggctg
aaatcggtgctggcggacccgtcggtgccggcgatgaacccggccgagaagggcttggcc
gacctgctctcacggtccactctggacgacggcgaacgcgccggcatcgccgggctgctc
gacgggttgctgtgggagctgcacaacaccgtgcagggccgggtgccggacccgatcgac
ctggtcgagatgcggcgcaccaccaacgccgccgagctgtccgcggcgctcgcccgcagg
tcggtcggcgccgacctgccggaagagctgctgcgcaacagcacgatgaaggcgctcgtc
gactcgttcggcgacgtccccgggctgcggcgggaggtcctcgggttcgaccacctccac
ggcaccggcgcaagcacgaccagcgcggtgctcgccgtgcagcagttcttcgagtgcgct
gccccgcaagcggttgcggtcgtgggtgacctgatcaccgcgcggttgcggcagatcgtg
tcgatcatcgccgagctgccctcgctggcggacgagtaccagctcgacgagaccgcgcgc
gccgggctgcaccgctacgcggaggcgctcaagtcgtggctcgccggcgagctcctgtgg
tcaacgagatccggccggttcagctcctcccccacccccaccgggcggtcgttgcaccgg
ccgtcaggactcggcacggccgcggtcctggtccgctag

DBGET integrated database retrieval system