KEGG   Lentzea guizhouensis: BBK82_39560Help
Entry
BBK82_39560       CDS       T04448                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
led  Lentzea guizhouensis
Pathway
led02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:led00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BBK82_39560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:led02000]
    BBK82_39560
Enzymes [BR:led01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     BBK82_39560
Transporters [BR:led02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    BBK82_39560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_29 SMC_N SbcCD_C AAA_22 Zeta_toxin AAA_23 AAA_30 MMR_HSR1 AAA_16 SRP54 AAA_25 TPR_11
Motif
Other DBs
NCBI-ProteinID: ANZ41171
UniProt: A0A1B2HTX1
Position
8279698..8281230
Genome map
AA seq 510 aa AA seqDB search
MTESPPPVVEMRGISLAFPGVKALQDVDFRLFPGEVHALMGENGAGKSTLIKTLTGVHRP
DSGQVVLAGADVAFSSPGEAQHAGISTVYQEVNLCANLTVAENILLGREPRKRGGIDFPA
MRKRAAEVLSRIGVHIDPGSSLGEHPIAVQQLVAIARAIAVDCRVLVLDEPTSSLDAGEV
AELFRIMRVLRDEGVAILFVSHFLDQVYEISDRMTVLRNGALVGEHLTAEVDRRALIAQM
IGRDLGALEAIEDAAEQRQARGPVLVHAEGLGRRGAIEPFDLEIRAGEVVGLAGLLGSGR
TELARLLFGADKADSGRVLVDGTPLRLRGPRSAIAAGIAFSSEDRKGEGLVADLSIRDNL
VLAMQAARGWTRPLSRRTKDQLVEKYLTALDIRPANPDALVRTLSGGNQQKVLLARWLVT
EPRLLILDEPTRGIDIGAKAQIQQLVTTLAAEGTAVLFISAELEEVVRIADRIVVLRDRR
KIAELDGSVTGVDEVVELIAGGAAPEKVVS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtcaccgccgccggtggtcgagatgcggggcatcagcctcgcgtttcccggc
gtgaaggcgttgcaggacgtcgacttccggttgttccccggtgaggtgcacgctctcatg
ggcgagaacggcgccgggaagtccaccctgatcaagaccctgaccggcgtgcaccgcccc
gacagcggccaggtcgtgctggcgggcgccgacgtggcgttctcctcccccggcgaggcg
cagcacgccgggatcagcacggtgtaccaggaggtcaacctctgcgcgaacctcacggtc
gcggagaacatcctgctgggccgcgaaccccgcaagcgcggcgggatcgacttcccggcc
atgcgcaagcgcgccgccgaggtcctctcccgcatcggcgtgcacatcgaccccggctcc
agcctcggcgagcacccgatcgcggtgcagcagctggtcgccatcgcccgtgcgatcgcc
gtcgactgccgcgtgctcgtgctcgacgagcccacgtccagtttggacgcgggtgaggtc
gcggagctgttccgcatcatgcgggtgctgcgcgacgagggtgtggcgatcctgttcgtg
tcgcacttcctggaccaggtctacgagatctccgaccggatgacggtgctgcgcaacgga
gccctcgtcggcgagcacctcaccgccgaggtcgaccggcgcgcgctcatcgcccagatg
atcggccgcgacctcggtgccctggaggcgatcgaggacgccgccgagcagcggcaggca
cgggggccggtgctggtgcacgcggagggcctcggccgccgcggtgccatcgagccgttc
gacctggagatccgcgcgggtgaggtggtcggtctggctggtctgctcggctccggtcgc
accgagctcgcccggctgctgttcggcgcggacaaggccgactccggccgcgtgctcgtc
gacggcacgccgctgcggctgcgcgggccgcggtcggcgatcgccgccgggatcgcgttc
agctcggaggaccgcaagggcgagggcctggtggcggacctctcgatcagggacaacctg
gtgctcgccatgcaggccgcgcgcgggtggacccggccgctgtcgcgcaggacgaaggac
cagctggtcgagaagtacctgacggcgctggacatccgcccggccaacccggacgcgctg
gtgcgcaccctgtccggtggcaaccagcagaaggtcctgctcgcccgctggctcgtcacg
gagccgcggctgctgatcctggacgagccgaccagaggcatcgacatcggcgcgaaggcc
cagatccagcagctcgtcacgaccctggccgcggagggcaccgcggtgctgttcatctcc
gccgagctcgaggaggtcgtgcgcatcgcggaccggatcgtggtgctgcgcgaccggcgc
aagatcgccgagctggacgggtcggtcaccggcgtggacgaggtggtcgagctcatcgcg
ggcggagccgcacccgagaaggtggtgtcatga

DBGET integrated database retrieval system