KEGG   Lentzea guizhouensis: BBK82_40835Help
Entry
BBK82_40835       CDS       T04448                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
led  Lentzea guizhouensis
Pathway
led00260  Glycine, serine and threonine metabolism
led01100  Metabolic pathways
led01110  Biosynthesis of secondary metabolites
led01120  Microbial metabolism in diverse environments
led01130  Biosynthesis of antibiotics
led01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBK82_40835
Enzymes [BR:led01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BBK82_40835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ANZ41370
UniProt: A0A1B2HUF3
Position
8572998..8574053
Genome map
AA seq 351 aa AA seqDB search
MTIEPLHDTGWRAFASDNYAGVLPEALTAIAAANGGHQVSYGDDVYTARLQEVVRERFGE
RAEVFPVFNGTGANVMALTSVLPRWGAVVSAATAHVNVDEGGAPERMTGLKLLTVPTPDG
KLTPELIAQQAWGWGDEHRAQPLAVSISQTTEMGTLYTPGELRAICDYSHERGMAVHVDG
SRLWNAAAALGVPFREFTTDVGVDVISLGGTKAGLLAVEAVVVLDPDRATGLRYLRKMMM
QLSSKMRFASAQLLALFDDDLGVRTAAHANAMAARLRTALEAVPGLTFTQETAANAIFVA
LPVEVADRIRKRVRFYDWDRARGEVRWMTAWDTTESDVDAFVALVREELGA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgagccgctgcacgacaccggctggcgagccttcgccagcgacaactacgcc
ggggtgctcccggaggcactcaccgccatcgccgcggccaacggtggccatcaggtgtcc
tatggcgacgacgtctacacggcccggctgcaggaggtcgtgcgcgagcggttcggtgag
cgcgcggaggtgttcccggtcttcaacggcaccggtgcgaacgtcatggcgctcaccagc
gtcctgccgcgctggggtgcggtcgtctcggcggccaccgcgcacgtcaacgtcgacgag
ggcggtgcgccggagcggatgaccgggctcaagctgctgaccgtgccgacgccggacggc
aagctgacgccggagctcatcgcgcagcaggcgtggggctggggtgacgagcaccgggcg
cagccgttggccgtgagcatctcccagaccaccgagatggggacgctctacacgcccggc
gagctgcgggcgatctgcgactactcgcacgagcgcggtatggccgtgcacgtcgacggg
tcccggctgtggaacgcggcggccgccctcggggtgcccttccgcgagttcaccaccgac
gtgggcgtggacgtgatcagcctcggcggcacgaaggccgggctgctggccgtggaggcc
gtggtcgtgctcgaccccgaccgcgcgaccgggctgcgctacctgcgcaagatgatgatg
cagctgtccagcaagatgcggttcgcctccgcccagctgctcgcgctgttcgacgacgac
ctgggcgtgcggaccgcggcccacgcgaacgcgatggccgcccggctgcggaccgcgctg
gaggccgtgccgggcctgaccttcacccaggagacggccgcgaacgcgatcttcgtggcg
ctgccggtggaggtggcggaccggatccgcaagcgggtgcggttctacgactgggaccgt
gcgcgcggtgaggtgcgctggatgacggcgtgggacacgacggagtccgatgtggacgcc
ttcgtggcgctcgtccgggaggagctgggcgcgtga

DBGET integrated database retrieval system