KEGG   Lentzea guizhouensis: BBK82_42310Help
Entry
BBK82_42310       CDS       T04448                                 

Definition
(GenBank) hypothetical protein
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
led  Lentzea guizhouensis
Pathway
led00340  Histidine metabolism
led01100  Metabolic pathways
led01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BBK82_42310
Enzymes [BR:led01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     BBK82_42310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3567
Motif
Other DBs
NCBI-ProteinID: ANZ41605
UniProt: A0A1B2HVA5
Position
complement(8892449..8894134)
Genome map
AA seq 561 aa AA seqDB search
MTMTIADQTRDDTRLAGADAAPSPTDQDFALPPGGVPEPQRKAVLDKLENYFADLQGRFL
GYQTNEDLKLREPMARFLDYHFNNVGDPFEDSHFTLHTRWAERAVLDYYAKLWHGKPRTK
VNGEVPKDAYWGYVLTMGSSEGNNYALWNARDYLSGKTLMREPAKDGGAQYVWVQDTAPA
DNQNAYSPVGFYSHDTHYSVAKALRVLNIPHFYEVGTKLYPYANPLDPGKPWDHEVPSTG
GDSGPGSIDVDKLARLVEFFASMGHPVMINLNYGSTFKGAYDDVAGICDRLRPIFARYGL
DKRKVRYGRDENGNELVDERTGHWIHVDGALAATYAPFIEKLVDAGEIKPATPLPKFDFR
IPEVASIVTSGHKYPGAPWPCGVFMTKANLQMQPPEQPAVIGSPDTTFGGSRNAFSPLVM
WHFLAKHSERDQMTMIRTALEVTDHAEKKLKELGGTWEAARTPLALTVRFKQPPPELVHK
YSLATIPLKVGHEVLHYAHLYVMPHVTKEMIDALVADLAKTSPVSMPVQRGGADLATYVD
GSADTGDIARLALVHVSGSAF
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgaccatcgcagaccagacacgggacgacacgcgcctagcgggcgcggacgcc
gcgccgagcccgacggaccaggacttcgcacttcctccgggaggtgtgcccgagccccag
cgcaaggcggtgctggacaagctggagaactacttcgcagacctccagggcaggttcctc
ggctaccagaccaacgaggacctcaagctgcgcgagccgatggcccggttcctcgactac
cacttcaacaacgtcggcgacccgttcgaggactcgcacttcaccctgcacacgcggtgg
gccgagcgcgcggtcctggactactacgccaagctgtggcacggcaagccgcgcaccaag
gtcaacggcgaggtgcccaaggacgcctactggggttacgtgctcaccatgggctcctcc
gagggcaacaactacgccctgtggaacgcccgcgactacctctccggcaagaccctcatg
cgtgaaccggccaaggacggcggcgcgcagtacgtgtgggtgcaggacaccgcgcccgcc
gacaaccagaacgcctactcacccgtgggcttctactcgcacgacacgcactactcggtg
gccaaggcgctgcgggtgctgaacatcccccacttctacgaggtcggcaccaagctgtac
ccgtacgccaacccgctggacccgggaaagccgtgggaccacgaggtgccgtccaccggc
ggcgacagcggaccgggcagcatcgacgtggacaagctggcgaggctggtggagttcttc
gcgagcatgggccacccggtgatgatcaacctcaactacggcagcacgttcaagggcgcc
tacgacgacgtcgccggcatctgcgatcggctgcggccgatcttcgcccgttacgggctg
gacaagcggaaggtccgctacggtcgcgacgagaacggcaacgagctggtcgacgaacgc
accggccactggatccacgtcgacggcgcgctcgcggcgacctacgcgccgttcatcgag
aagctcgtcgacgccggcgagatcaagccggccaccccgttgccgaagttcgacttccgc
atccccgaggtcgcctccatcgtcaccagcgggcacaagtaccccggcgccccctggccg
tgcggcgtgttcatgaccaaggcgaacctccagatgcagccgccggagcagcccgccgtg
atcgggtcgccggacaccaccttcggcgggtcgcgcaacgcgttctcgccgctggtcatg
tggcacttcctggccaagcactccgagcgcgaccagatgacgatgatccgcacggccctg
gaggtcaccgaccacgcggagaagaagctgaaggagctgggcggcacgtgggaggccgcg
cgaacgccgctggcgctcacggtgcggttcaagcagcctccgcccgagctcgtgcacaag
tactcgctggccacgatcccgctcaaggtggggcacgaggtcctccactacgcgcacctg
tacgtgatgccccacgtcacgaaggagatgatcgacgcgctggtggccgacctcgccaag
accagcccggtcagcatgccggtgcagcgcggcggcgcggacctggcgacctatgtggac
ggttcggccgacaccggcgacatcgcccgcctggccctggtgcacgtctccggcagcgcg
ttctag

DBGET integrated database retrieval system