KEGG   Lentzea guizhouensis: BBK82_45815Help
Entry
BBK82_45815       CDS       T04448                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
led  Lentzea guizhouensis
Pathway
led00562  Inositol phosphate metabolism
led00564  Glycerophospholipid metabolism
led00565  Ether lipid metabolism
led01100  Metabolic pathways
led01110  Biosynthesis of secondary metabolites
led02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:led00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BBK82_45815
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBK82_45815
   00565 Ether lipid metabolism
    BBK82_45815
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBK82_45815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:led02042]
    BBK82_45815
Enzymes [BR:led01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BBK82_45815
Bacterial toxins [BR:led02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BBK82_45815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: ANZ42170
UniProt: A0A1B2HWR1
Position
complement(9668852..9670798)
Genome map
AA seq 648 aa AA seqDB search
MSLSRRGFMAAAVAAASGTLLPPSVYAALAREPRSGGLRAIKHVVLLMQENRSFDHYYGS
LRGVRGFSDRNALKGVFNQTGVLPFPVREAASGRDIQYIGDLDHSWNGGHAALRGGWNDN
WVPAKTAATMAFYTRQDIPFHYELADTFTLCDAYHCSVPTSTSPNRNYWVSGYTGYEPNG
TRATGNAAYAEDTHAGYTWKTYPERLEAAGKSWRVYQEWDNFQDNNLEFFVRFKEIARKV
LPAGFKSLDKLYGTGDPALIGAIDLSKLTPAEKSLYDRGLQRVRPGGLGEAFRADVSSGS
LPAVSYLVPSSVDSEHPGASSPAASASITYQVLDALASNQEVWESTVLFITYDENDGFYD
HVPPPRPPLSVTDEYVGDKPLGLGTRVPMTVVSPWSVGGYVCSQVFDHTSMTQFLEKWTG
VRSEEISAWRRTVSGDLTSAFDFDRRRTWPEVGEPAPVPPATPRWRPAPPSEQKMPEQEA
GRRRARALPYQPDASLRGSRLEMSNTGSASVHLALYPYSAQFALPQHFDVARAASVELPG
DHDLVLLGPNGFRREFAGSASDSARVSSSVRGYSRVLTLTFENSGRSRLTFVLGRRRIVV
RPGHRHVIPWLTVMNSGWYDLTVTVEEEPRFRRRLCGHIENGQESISG
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctctctcgtcgtgggttcatggctgccgccgtcgctgctgcctccggcacgctg
ctgccgccgtcggtgtacgccgcgctcgctcgcgaaccgcgctcgggagggttgcgcgcg
atcaagcacgtggtgctgctgatgcaggagaaccgctcgttcgaccactactacgggtcg
ctgcgcggggtgcgcgggttctccgaccgcaatgccttgaagggcgtgttcaaccagacc
ggggtgctgccgttcccggtccgcgaggccgcctctggacgcgacatccagtacatcggt
gacctcgaccacagctggaacgggggtcacgcggccctgcgcggtggctggaacgacaac
tgggtgcccgcgaagacggccgccaccatggcgttctacacgcgccaggacatcccgttc
cactacgagctcgccgacacgttcacgctgtgcgacgcctaccactgctcggtgccgacc
tcgacctcgccgaaccgcaactactgggtgtccggctacaccggctacgagcccaacggc
acgcgggcgaccggcaacgcggcctacgccgaggacacccacgccggctacacctggaag
acctacccggaacgcctggaggcggccgggaagtcgtggcgggtgtaccaggagtgggac
aacttccaggacaacaacctggagttcttcgtgcggttcaaggagatcgcgcgcaaggtg
ctgccggccgggttcaagtcgctggacaagctctacggcaccggcgaccccgcgttgatc
ggcgcgatcgacctgtcgaagctgacgccggccgagaagtcgctgtacgacaggggcttg
cagcgggtgcggccgggcgggctgggggaggcgttccgcgcggacgtgagctccggctcg
ttgcccgccgtgtcgtacttggtgccgtcgtcggtggactccgagcaccccggcgcgtcg
tcacccgccgcctcggcctcgatcacctaccaggtgctggacgcgctggcctccaaccag
gaggtgtgggagtcgacggtcctgttcatcacctacgacgagaacgacgggttctacgac
cacgtgccgccgccgcgcccgccgttgtccgtcaccgacgagtacgtgggcgacaagccg
ctggggttgggcacccgtgtgccgatgaccgtcgtctcgccgtggtcggtcggcgggtac
gtgtgttcgcaggtgttcgaccacacgtcgatgacgcagttcctggagaagtggaccggt
gtgcggtcggaggagatctccgcgtggcgccggaccgtgtcgggtgacctgacctcggcg
ttcgacttcgaccgccgccgcacctggcccgaggtcggcgagcccgcgcccgtgccgccc
gccacgccgcgctggcgacccgcgccgccgtccgagcagaagatgccggagcaggaagca
ggacgccgccgtgcgcgcgcgttgccctatcagcccgatgcgtcgcttcgcggttcacgg
ctggagatgtccaacacgggttccgcgtccgtgcacctcgcgttgtacccgtactcggcc
cagttcgcgctgccgcagcacttcgacgtggcccgcgcggcgtcggtggagctgcccggc
gaccacgacctggtgctgctcgggccgaacgggttccgccgtgagttcgccggctctgcg
tctgacagtgcgcgcgtgtcgtcgtcggtgcgcggatacagccgtgtgctcacgttgacg
ttcgagaactccgggcgttcgcggctgacgttcgtgctggggcggcggcggatcgtggtg
cggcccggccaccggcacgtgatcccgtggctgaccgtgatgaactccggctggtacgac
ctgaccgtcacggtggaggaggagccgcggttccgccgtcgtctgtgcggtcacatcgag
aacggccaggagtcgatctccggctaa

DBGET integrated database retrieval system