KEGG   Leclercia sp. W17: DVA44_00540Help
Entry
DVA44_00540       CDS       T05987                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
lee  Leclercia sp. W17
Pathway
lee00540  Lipopolysaccharide biosynthesis
lee01100  Metabolic pathways
Module
lee_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:lee00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DVA44_00540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:lee01005]
    DVA44_00540
Enzymes [BR:lee01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     DVA44_00540
Lipopolysaccharide biosynthesis proteins [BR:lee01005]
 Unusual sugar
  DVA44_00540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short KR Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AXF62741
UniProt: A0A345C4N6
Position
complement(107195..108127)
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLNIADYMDKEDFLIQI
MAGEEFGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKEILHYCLEREIPFLYASSAATY
GGRTSDFIESREYEQPLNVYGYSKFLFDEYVRQVLPEANSQIVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGESPKLFEGSDGFKRDFVYVGDVAAVNLWFWENGVSGIFNLGTGRA
ESFQAVADAALAYHQKGTIEYIPFPDKLKGRYQAFTQADLTNLRAAGYDKPFKTVAEGVT
EYMAWLNRDA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttaccggcggcgcgggctttatcggcagcaatattgttaaagctctcaat
gacaaaggcatcaccgacattttggtggtggataacctgaaagacggcaccaagtttgta
aacctggtggatctgaacattgccgactacatggataaagaagattttctgatccagatt
atggcgggcgaagagttcggcgatatcgacgcaatcttccatgaaggtgcttgctcctcc
accaccgagtgggacggcaagtacatgatggacaacaactatcagtactccaaagagatc
ctgcactactgcctggagcgcgaaattccgttcctgtacgcctcttccgcggcgacctat
ggcgggcgtacctccgactttatcgagtcccgcgagtatgagcagccgctgaacgtctac
ggctactccaagttcctgtttgacgaatatgtacgccaggtactgccagaagcgaactcc
cagattgtcggcttccgctacttcaacgtctacggaccgcgcgaaggtcacaaaggcagc
atggcgagcgtggccttccacctcaacacgcagctgaataatggcgaaagtccgaaactg
tttgaaggcagcgatggctttaagcgtgacttcgtttacgtgggcgatgtggcggcggtg
aacctgtggttctgggaaaacggcgtctccggcatcttcaacctgggcaccggccgggcg
gaatccttccaggcggtggcggacgcagcgctggcgtatcaccagaaaggcaccattgag
tacatcccgttcccggacaagctgaaaggccgctatcaggcattcacccaggcggatctg
accaacctgcgtgccgctggctatgacaagccgttcaagaccgttgccgaaggggtaacg
gaatatatggcctggctgaaccgcgacgcgtaa

DBGET integrated database retrieval system