KEGG   Leclercia sp. W17: DVA44_01685Help
Entry
DVA44_01685       CDS       T05987                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
lee  Leclercia sp. W17
Pathway
lee02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DVA44_01685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:lee02022]
    DVA44_01685
Two-component system [BR:lee02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   DVA44_01685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AXF62944
UniProt: A0A345C589
Position
354738..355457
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaattataagattctggtggtggatgacgacatgcgcctccgtgcgctcctt
gagcgttatctgaccgagcagggcttccaggttcgtagcgtggctaacgccgaacagatg
gatcgcctgctgacccgtgaatccttccacctgatggtgctggatctgatgctgccaggc
gaagatggcctctctatctgccgtcgtctgcgcagccaaagcaacccaatgccgatcatt
atggtgacggcgaaaggggaagaagttgaccgtatcgtgggtctggaaattggcgccgac
gactacattccaaaaccgtttaacccgcgtgagctgctggcgcgtatccgtgccgtactg
cgccgtcaggcgaacgaactgcctggcgcaccgtcgcaggaagaggcggtgatcgccttc
ggtaagttcaagctgaatctcggcacccgcgagatgttccgcgaagatgagccgatgccg
ctcaccagcggcgagttcgcggtcctgaaagcgctggtcagccacccgcgcgagccgctg
tctcgcgataagctgatgaacctggcccgtggtcgtgaatactccgcgatggagcgttcc
atcgacgtacagatctcccgcctgcgccgcatggtggaagaggatccggcgcatccgcgc
tatatccagaccgtctggggtctgggctacgtgtttgtcccggacggctctaaagcatga

DBGET integrated database retrieval system