KEGG   Leclercia sp. W17: DVA44_07625Help
Entry
DVA44_07625       CDS       T05987                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lee  Leclercia sp. W17
Pathway
lee00450  Selenocompound metabolism
lee00970  Aminoacyl-tRNA biosynthesis
lee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lee00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DVA44_07625
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DVA44_07625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lee01007]
    DVA44_07625
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lee03016]
    DVA44_07625
Enzymes [BR:lee01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DVA44_07625
Amino acid related enzymes [BR:lee01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DVA44_07625
Transfer RNA biogenesis [BR:lee03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DVA44_07625
 Prokaryotic type
   Other AARSs
    DVA44_07625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AXF64011
UniProt: A0A345C8A6
Position
complement(1564442..1566475)
Genome map
AA seq 677 aa AA seqDB search
MTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIM
LKAQQLGISPEQMIAEMSQEHQTDFAGFDISYDNYHSTHSDENRELSELIYTRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIEPKSVVSG
ATPEMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTTSFDEYWKKDSTAELYHFIGKDIVY
FHSLFWPAMLEGSGFRKPTNLFVHGYVTVNGAKMSKSRGTFIKASTWLNHFDADSLRYYY
AAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFIAKRFDGVMAAELADPELYK
TFTDAAAVIGEAWESREFGKAVREIMALADLANRYVDEQAPWVVAKQEGRDADLQAICSM
GINLFRVLMSYLKPVLPQLAARTEAFLNTELSWDSINQPLLGHKLNAFKALYNRIEMKQV
EALVEASKEEVKAAAAPVTGPLADDPIQETISFDDFAKVDMRVALIENAEFVEGSDKLLR
LTLDLGGEKRNVFSGIRSAYPDPQVLIGRHTVMVANLAPRKMRFGISEGMVMAAGPGGKD
IFLLSPDSGALPGHQVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgcgaaaaaaattctggtaacgtgcgctctgccgtacgctaacggctcc
atccacctcggccacatgctggagcatatccaggctgatgtctgggtccgttaccagcga
atgcgcggccacgaggtaaacttcatctgtgcagacgacgcgcacggcacgccaatcatg
ctgaaagcgcagcagctgggtatctccccggagcagatgattgccgaaatgagtcaggag
catcagaccgattttgctggcttcgacatcagctatgacaactatcattccacgcacagc
gacgaaaaccgtgagctgtcggagctgatctatacccgtctgaaagagaatggttttatc
aaaaaccgcaccatctctcagctctacgatccagaaaaaggcatgttcctgccggaccgt
ttcgtgaaaggcacctgcccgaaatgtaaatctccggaccagtatggcgataactgcgaa
gtgtgcggcgcaacctacagcccaaccgagctgattgagccaaagtccgtggtttccggc
gcgacgccagagatgcgtgattccgaacacttcttcttcgacctgccgtcgttcagcgaa
atgctgcaggcgtggacccgcagcggcgcgctgcaggaacaggtggcgaacaagatgcag
gagtggtttgaatccggcctgcagcagtgggatatctcccgcgatgcgccatacttcggc
ttcgaaatcccgaacgcaccgggcaaatacttctacgtctggctggatgcgcctatcggc
tacatgggctccttcaagaacctgtgcgacaagcgcggcgataccaccagcttcgacgaa
tactggaagaaagattccaccgccgagctgtatcacttcatcggcaaagacatcgtttac
ttccacagcctgttctggcctgccatgctggaaggcagcggtttccgcaagccaaccaac
ctgtttgtccacggctatgtaaccgtgaacggcgcgaagatgtccaaatcgcgcggcacc
ttcattaaggccagcacctggctgaaccactttgatgccgacagcctgcgctactactac
gcagcgaagctctcttcccgtatcgacgatatcgacctgaacctggaagatttcgtccag
cgcgttaatgctgacatcgtgaacaaagtggtcaacctggcttcccgtaacgccggcttt
atcgccaagcgtttcgacggcgtgatggcggcggaactggcggatcctgagctgtacaaa
accttcaccgacgcggctgccgtaattggcgaagcgtgggagagccgcgagtttggtaaa
gcggtgcgtgaaatcatggccctggccgacctcgctaaccgctacgttgacgagcaggca
ccgtgggtagttgccaaacaggaaggccgcgacgctgacctgcaggcgatctgctccatg
gggatcaacctgttccgcgtgctgatgtcttacctcaagccggttctgccgcagctggcc
gcgcgtactgaagcgttcctgaacaccgaactgagctgggacagcatcaatcaaccgctg
ctcggccataagctgaacgccttcaaggcgctctacaaccgcatcgagatgaagcaggtt
gaagccctggttgaagcctcgaaagaagaggtgaaagccgccgccgcgccggttaccggc
ccgctggcggacgatccgattcaggagaccatcagtttcgatgatttcgccaaagtcgat
atgcgcgtggcgctgattgaaaacgcggaatttgtggaaggctccgataagttgctgcgc
ctgaccctcgatctgggcggcgagaagcgcaacgtcttctccggtattcgttccgcctat
ccagatccgcaggtgctgattggccgccacacggtgatggtggcgaacctcgcaccgcgc
aaaatgcgcttcggcatctctgaggggatggtgatggccgcaggtcctggcgggaaagat
atcttcctgttaagcccggacagcggtgcgctgcctggtcatcaggtgaaataa

DBGET integrated database retrieval system