KEGG   Leclercia sp. W17: DVA44_11330Help
Entry
DVA44_11330       CDS       T05987                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lee  Leclercia sp. W17
Pathway
lee00480  Glutathione metabolism
lee00590  Arachidonic acid metabolism
lee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    DVA44_11330
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DVA44_11330
Enzymes [BR:lee01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DVA44_11330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AXF64652
UniProt: A0A345CA47
Position
2308996..2309478
Genome map
AA seq 160 aa AA seqDB search
MTTFYQLTATSLRGQPISMADYAGKVVLVVNTASQCGFTPQYAGLEKLYKKYADQGLIVL
GFPCNQFGKQEPGGADDIAQTCHVNYGVSFPMFGKVEVNGATAHPLFRYLKEALPGVLGG
RIKWNFTKFLIGRDGKPLKRFAPMTTPEKMEAAIVAALER
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccttttatcaacttacggccaccagcctgcgcggtcagcccatttctatggcc
gactatgcggggaaggttgtgctggtggtgaacactgccagccagtgtggctttacaccc
cagtacgctggtcttgaaaaactctacaaaaagtatgccgaccaggggctgatagtgctg
ggtttcccctgcaatcagttcggtaagcaggagcctggcggcgcggacgacattgcccag
acctgtcacgtcaattacggcgtcagcttcccgatgttcgggaaagtggaggtcaatggc
gcaacagcgcatcctctgtttcgttatctgaaagaggcgttgcccggcgtactgggggga
cgaatcaagtggaatttcaccaagttccttatcggacgcgacggcaaaccgctcaaacgt
tttgcaccgatgaccactccggagaaaatggaagccgctatcgtcgctgcacttgaacgc
tga

DBGET integrated database retrieval system