KEGG   Leclercia sp. W17: DVA44_12035Help
Entry
DVA44_12035       CDS       T05987                                 

Definition
(GenBank) alcohol dehydrogenase AdhP
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lee  Leclercia sp. W17
Pathway
lee00010  Glycolysis / Gluconeogenesis
lee00071  Fatty acid degradation
lee00350  Tyrosine metabolism
lee00625  Chloroalkane and chloroalkene degradation
lee00626  Naphthalene degradation
lee01100  Metabolic pathways
lee01110  Biosynthesis of secondary metabolites
lee01120  Microbial metabolism in diverse environments
lee01130  Biosynthesis of antibiotics
lee01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DVA44_12035
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DVA44_12035
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DVA44_12035
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DVA44_12035
   00626 Naphthalene degradation
    DVA44_12035
Enzymes [BR:lee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DVA44_12035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C CoA_binding Methyltransf_31 Methyltransf_11 DUF2284
Motif
Other DBs
NCBI-ProteinID: AXF64785
UniProt: A0A345CAI0
Position
complement(2457808..2458818)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHQVEVTEKTLRPLKHGEALLKMDCCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVKEVGPGVTSLKPGDRTSVAWFFEGCGHCEYCNSGNETLCRNVKNAGYSVDGGMAEE
CIVTADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSEIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAVDINDEQLKLAESMGADLVVNSRNEDAAKFIQEKTGGAHAAVVTAVAKV
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLGDINAIFKEMEQGQIRGRMVIDFRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgtgaccaaagaccatcaggtagaagtgaccgagaaaaccctgcgc
ccgctgaaacacggggaagcgctgctgaagatggattgctgtggcgtctgccataccgat
cttcacgtcaaaaacggtgattttggcgataagaccggggtgatcctcggccatgaaggc
atcggtgtcgtcaaggaggttggccctggtgtcacctcgctgaaaccaggagatcgcacc
agcgtggcgtggttcttcgaaggctgcggccactgcgaatactgtaactccggtaacgaa
accctgtgccgtaacgtgaagaacgcgggctactctgtggacggtgggatggcggaagag
tgtatcgtcactgccgattatgcggtaaaagtgccggacggcctggattccgccgccgcc
agcagtatcacctgcgccggggtaacgacctataaagcggtaaaagtctctgagattaag
cctggtcagtggatcgctatctatggcctcggcgggctggggaaccttgcactgcagtac
gccaaaaacgtgttcaacgccaaagtgattgcggttgatatcaatgatgaacagctgaaa
ctggccgagagcatgggggccgatctggtggtcaactcgcgtaatgaagatgccgctaaa
ttcatccaggaaaagaccggcggcgcacacgctgcggtggtaacggccgtggcgaaagtg
gcctttaactctgcggtagatgccgttcgcgccggtggccgtgtggtcgccgtgggcctg
ccgccggaagcgatgagccttgatattccacgtctggtgctggatggcattcaggtggtg
ggctcgctggtgggcacccgtcaggacctgaccgaagccttccagtttgccgccgaaggt
aaagtggtgccgaaagtggcgctgcgtccgctgggggatatcaacgccatctttaaagag
atggagcaaggccagatccgtggccgtatggtgatcgatttccgttcataa

DBGET integrated database retrieval system