KEGG   Leclercia sp. W17: DVA44_16415Help
Entry
DVA44_16415       CDS       T05987                                 

Definition
(GenBank) oxygen-insensitive NADPH nitroreductase
  KO
K10678  nitroreductase [EC:1.-.-.-]
Organism
lee  Leclercia sp. W17
Pathway
lee00633  Nitrotoluene degradation
lee01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lee00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DVA44_16415
Enzymes [BR:lee01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     DVA44_16415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase
Motif
Other DBs
NCBI-ProteinID: AXF65570
UniProt: A0A345CCR5
Position
complement(3307118..3307840)
Genome map
AA seq 240 aa AA seqDB search
MTPVIDLLRSHRSIRHFTDQPISDAQREAILAGAQGTSSSSFLQCSSIIRITDPAMREQL
VTLTGGQKHVAEAAEFWVFCADFNRHLQICPEAQLGLAEQLLLGVVDTAMLAQNAMTAAE
SLGLGGVYIGGIRNSIEAVTELLQLPKHVLPLFGLCLGWPADNPDVKPRLPAAMVMHENH
YQPVDKAVLAQYDEELANYYLSRATNNRRDTWSDHIRRTIIKENRPFILDYLHKQGWATR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgtaattgatctgcttcgttcccaccgttccattcgccattttaccgatcaa
cccatcagcgatgcccagcgtgaggccattcttgccggtgcgcagggtacctccagctcc
agcttcctgcagtgcagctccatcattcgcatcaccgatcccgcgatgcgcgagcagctg
gtgaccctcaccggcgggcagaagcacgtggccgaggcggcggagttctgggtcttctgc
gccgacttcaaccgccatctgcaaatctgccctgaggcgcagctgggcctcgccgagcag
ctgctgctgggcgtggtggataccgcgatgttggcgcagaacgcgatgacggcggcggag
tcgctgggtctgggcggggtttacattggcggtatccgcaacagcattgaggcggtgacc
gaactgctgcagctgccgaagcacgtcctgccgctgtttggcctctgcctcggctggccg
gcggataacccggacgtcaagccgcgcctgcctgcggcgatggtgatgcatgaaaatcac
taccagccggtcgataaagcggtgctggcgcagtacgacgaggaactggcgaactactac
ctcagccgcgcgactaataaccgccgcgacacctggagcgaccatatccggcgcaccatc
atcaaggaaaaccgtccgtttattctcgactatttgcataaacagggctgggcgacgcga
taa

DBGET integrated database retrieval system