KEGG   Leclercia sp. W17: DVA44_18705Help
Entry
DVA44_18705       CDS       T05987                                 

Definition
(GenBank) (2E,6E)-farnesyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
lee  Leclercia sp. W17
Pathway
lee00900  Terpenoid backbone biosynthesis
lee01100  Metabolic pathways
lee01110  Biosynthesis of secondary metabolites
lee01130  Biosynthesis of antibiotics
Module
lee_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:lee00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DVA44_18705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:lee01006]
    DVA44_18705
Enzymes [BR:lee01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     DVA44_18705
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     DVA44_18705
Prenyltransferases [BR:lee01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   DVA44_18705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt Arm-DNA-bind_3
Motif
Other DBs
NCBI-ProteinID: AXF65979
UniProt: A0A345CDX4
Position
3767132..3768031
Genome map
AA seq 299 aa AA seqDB search
MDFSNQLQACVERANDALRRFIEPQPFQNTPLVEAMHYGALLGGKRLRPFLVYATGRMFD
ISLDTLDAPAAAVECVHAYSLIHDDLPAMDDDDLRRGQPTCHIKFGEANAILAGDALQTL
AFSILSDAPMVEVADRDRLAMVSELAMASGVAGMCGGQALDLEAEGRQVNLELLERIHRH
KTGALIRAAVRLGALSAGERGREALPILDRYAESIGLAFQVQDDILDVVGDTATLGKRQG
ADQQLGKSTYPALLGLEQARQKARDLIADARQSLEQLAAQSLDTSALEALADYIIQRDK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggatttttcgaaccagcttcaggcgtgtgtcgagcgagctaacgacgcactgcgccgt
tttatagaaccacagccttttcagaacactccactggttgaggccatgcattatggcgca
ctgttaggcggtaagcgcctgcgtccttttctggtctatgccaccggcagaatgttcgat
atcagtctggatacgctggatgccccggccgctgcggtagagtgtgttcatgcctattcg
ctgatccatgacgatctcccggcgatggacgatgacgatctgcgccgcgggcaaccaacc
tgccatattaagtttggcgaagcgaatgccattctggcaggcgatgccctgcaaacgctg
gcgttttcgatcctgagcgatgcaccgatggtggaagtggcggatcgcgaccgtctggcg
atggtttcggagctggcgatggccagcggcgttgccggcatgtgcggcggtcaggcgctg
gatctggaggcggaaggccgtcaggttaatctggaactgctggagcgcattcatcgtcac
aagaccggggcactgattcgcgccgccgttcgtctgggggcgctgagcgcgggtgagcga
ggacgcgaagccttaccgattctggatcgctacgcagaaagtatcggtttagcgttccag
gttcaggatgacattctggatgtcgtgggcgatactgcaacattgggtaaacgtcagggt
gccgatcagcagcttggcaaaagtacctatcccgcccttctgggccttgagcaagcccga
caaaaagcccgggacctgattgcggatgcccgtcagtcgcttgagcaactggctgcgcag
tcactggatacctcggcactggaagcgctagcggactatataatccagcgtgataaataa

DBGET integrated database retrieval system