KEGG   Lelliottia jeotgali: LJPFL01_0395Help
Entry
LJPFL01_0395      CDS       T05035                                 

Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
lef  Lelliottia jeotgali
Pathway
lef00564  Glycerophospholipid metabolism
lef01100  Metabolic pathways
lef01110  Biosynthesis of secondary metabolites
Module
lef_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:lef00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LJPFL01_0395
Enzymes [BR:lef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     LJPFL01_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_C48
Motif
Other DBs
NCBI-ProteinID: ASV53758
Position
complement(419542..420510)
Genome map
AA seq 322 aa AA seqDB search
MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDMKEAQKPDTASY
RTFNDFFVRPLRDDVRPLNTDPAVLVMPADGVISQLGKIEDDKILQAKGHDYSMEALLAG
NYLMADLFRNGSFVTTYLSPRDYHRVHMPCNGILREMIYVPGDLFSVNHLTAQNVPNLFA
RNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPREGVIKRWTWPAGESEGSIA
LLKGQEMGRFKLGSTVINLFAPGKVNLVETLSSLSVTKIGQPLAVSTETLVTPEAEPAPL
AEEEIEAEHDASPLVDDKKDQV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaactcatttaaactttcgcttcaatacattctgccaaaactatggctcacccgc
ctggcgggctggggcgcgagcaaacgagcgggctggctgactaagctggttatcgatctg
ttcgttaaatactacaaggtcgacatgaaagaggcgcagaagccggacaccgccagctat
cgcacctttaacgatttcttcgtccgcccgttgcgcgatgacgttcgtccgctgaatacc
gatccagccgtactggtgatgcctgctgacggcgtgatcagccagctcggcaaaattgaa
gatgacaaaatcctgcaggctaaaggccacgactacagcatggaagccctgctggcgggt
aactatctgatggcggacctgttccgcaacggttcgtttgtcaccacctacctgtctccg
cgcgactatcaccgcgtccacatgccgtgcaacggtatcctgcgtgaaatgatctacgtg
ccgggcgatctgttctcggtgaaccatctgacggcgcaaaacgttccgaacctgtttgcc
cgtaacgagcgcgtcatctgcctgtttgatactgaatttggcccaatggcgcagattctg
gtcggtgctaccattgtaggcagcatcgaaaccgtgtgggccgggaccatcaccccaccg
cgcgaaggcgtgatcaaacgctggacttggccggctggcgaaagcgaaggctcaattgcc
ctgctgaaaggtcaggaaatgggccgcttcaagctgggttcaacggttatcaacctgttc
gcaccgggcaaagtgaatctggtcgaaacgctttccagcctgtcggtgaccaaaatcggt
cagccgctggcggtttctactgaaaccctcgtgacgccggaagctgagccagctccgttg
gcagaagaagagatcgaagccgaacacgacgccagtccgctggttgacgataagaaagac
caggtctaa

DBGET integrated database retrieval system