KEGG   Lelliottia jeotgali: LJPFL01_0571Help
Entry
LJPFL01_0571      CDS       T05035                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lef  Lelliottia jeotgali
Pathway
lef00010  Glycolysis / Gluconeogenesis
lef00053  Ascorbate and aldarate metabolism
lef00071  Fatty acid degradation
lef00280  Valine, leucine and isoleucine degradation
lef00310  Lysine degradation
lef00330  Arginine and proline metabolism
lef00340  Histidine metabolism
lef00380  Tryptophan metabolism
lef00410  beta-Alanine metabolism
lef00561  Glycerolipid metabolism
lef00620  Pyruvate metabolism
lef00625  Chloroalkane and chloroalkene degradation
lef00903  Limonene and pinene degradation
lef01100  Metabolic pathways
lef01110  Biosynthesis of secondary metabolites
lef01120  Microbial metabolism in diverse environments
lef01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJPFL01_0571
   00053 Ascorbate and aldarate metabolism
    LJPFL01_0571
   00620 Pyruvate metabolism
    LJPFL01_0571
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LJPFL01_0571
   00561 Glycerolipid metabolism
    LJPFL01_0571
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LJPFL01_0571
   00310 Lysine degradation
    LJPFL01_0571
   00330 Arginine and proline metabolism
    LJPFL01_0571
   00340 Histidine metabolism
    LJPFL01_0571
   00380 Tryptophan metabolism
    LJPFL01_0571
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LJPFL01_0571
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LJPFL01_0571
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LJPFL01_0571
Enzymes [BR:lef01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     LJPFL01_0571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1304
Motif
Other DBs
NCBI-ProteinID: ASV53934
Position
601571..602980
Genome map
AA seq 469 aa AA seqDB search
MRHIEQIFINGEFVTPHGTERFDLYNPATAQVFGQVRLADDHDAERAIAAAKAAFPGWAK
TTREERIAALKRMHAAVTARHDELLEAIIEEYGAPASRSAWMASYPADVIAQAIDALESF
EFTTQTGAATVQMTPLGVAGLITPWNSDAGFICGKLAAALAAGCTAVIKPSEMSAWQTQI
ITEALNEAGLPAGVFNIVTGRGETVGETISRHPDVAKISFTGSTNTGKAILRNAAESFKR
VTLELGGKSPTIVLEDADLAEAVPLAIQAGLMNSGQACVAGTRILVPQSRKAECETALAE
AMAAVKSGDPRDPATEVGPMVSEKQWLRVQGYIRKGTQEGARLLAGGEGRPDGTQAGWFV
RPTLFTDVENQMTIARDEIFGPVLSILTYRDEDEAIAIANDTDYGLSALVLGGERAAVVA
QQIESGRVLVNTLAHEPKAPFGGFKHSGVGREMGAWGIGAFMEPKTIIG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatatcgaacagatttttattaacggcgaatttgtcacgccgcacggcacagag
cgttttgatctctacaatccagccaccgcgcaggtcttcggtcaggtccgtcttgcggat
gatcacgatgccgaacgcgcgattgcggcggcaaaagcagcgtttccgggatgggccaaa
accacccgtgaggagcggattgccgccctgaagcggatgcatgcggcggtcacggcgcgt
catgatgaattactggaagccataatcgaagagtacggtgcgcccgcgtcgcgctcggcg
tggatggcgagctatccggcagacgtgattgcccaggccatcgatgcgctggaaagcttt
gagttcaccactcagactggcgctgcgactgtgcagatgacgccgctcggcgtggcgggt
ctgataacaccgtggaacagcgatgccgggtttatctgcggcaaactggcggcggcgctg
gctgccggctgtacggcggtgatcaaaccgagcgaaatgagcgcgtggcaaacacagatt
atcaccgaagccctgaacgaagccgggctgcccgcaggcgtgtttaacatcgtcaccggg
cgcggtgaaacggtcggggagacgatcagtcgtcatccggacgtggcaaaaatctcgttc
accggttcaacgaacacgggcaaagcgatcctgcgtaatgcggcggagagttttaaacgc
gtcacgctagaattaggtgggaaatcgccgacgatcgttttggaagacgccgatttagcc
gaggcggttccgctggcgattcaggccgggctaatgaacagcgggcaggcgtgcgtcgcc
ggaacgcgtattctggtgccgcaatcgcgtaaagccgaatgcgaaacggcgctcgccgag
gcgatggcggcggtgaaatcgggcgacccgcgcgacccggcaacggaagtggggccgatg
gtcagcgaaaagcagtggcttcgcgtgcagggctatatccgcaaaggcactcaagagggc
gcacggctgctggcgggtggagaaggacgaccggacggaacacaggctggctggtttgtt
cgcccgacgctgtttaccgacgtggaaaaccagatgactatcgcacgcgacgagattttt
ggcccggttctgtcgatcctcacctatcgtgatgaggacgaagcgatcgccattgccaac
gacacggattacggcctgagcgcgctggtccttggcggtgagcgtgcggctgtcgtcgcg
cagcaaatcgaatctggccgtgtgctggtgaacaccctcgcccacgaaccgaaagcgcca
ttcggcggattcaaacattccggcgtaggccgcgaaatgggcgcgtgggggattggcgcg
tttatggagccgaagacgattattggctaa

DBGET integrated database retrieval system