KEGG   Lelliottia jeotgali: LJPFL01_2869Help
Entry
LJPFL01_2869      CDS       T05035                                 

Definition
(GenBank) Two-component sensor protein RcsC
  KO
K07677  two-component system, NarL family, capsular synthesis sensor histidine kinase RcsC [EC:2.7.13.3]
Organism
lef  Lelliottia jeotgali
Pathway
lef02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lef00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LJPFL01_2869
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lef01001]
    LJPFL01_2869
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:lef02022]
    LJPFL01_2869
Enzymes [BR:lef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     LJPFL01_2869
Protein kinases [BR:lef01001]
 Histidine kinases
  NarL family
   LJPFL01_2869
Two-component system [BR:lef02022]
 NarL family
  RcsC-RcsD-RcsB (capsule synthesis)
   LJPFL01_2869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsC Response_reg HATPase_c HisKA BRI3BP HATPase_c_3 PPP1R26_N
Motif
Other DBs
NCBI-ProteinID: ASV56232
Position
complement(3058352..3061198)
Genome map
AA seq 948 aa AA seqDB search
MKYLVSFRTTLKVSRYLFRALALLLWLLVALFSVFYIVNALHQKESEIRQEFNLSSDQAQ
RYIQRTSDVMKELKYIAENRLTAENGILATRGREDKSEVPDFEPLFPDSDCSAMGNAWRG
SLESLSWFMRYWRDNFSAAYDLNRVFLIGSENLCMADFGLRDMPVEREDALKSLHERILK
YRNAPQDERSNNIFWISQGPRPGVGYFYALTPVYLANRLQALLGTEQTIRMENFFTPGSL
PMGVTILDENGHKLISLTGPEDRLKVDPRWMQERSWFGYTSGFRDLVLKKSLPPSSLSIV
YSVPVDMVLERIRMLILNSILLNVLVGIALFTLARMYERKIFIPAENDAQRLEEHEQFNR
KIVASAPVGICILRTQDGTNILSNELAHNYLNMLTHEDRQRLTQIICGQQVNFVDVLTSN
HTNLQISFVHSRYRNENVAICVLVDVSSRVKMEESLQEMAQAAEQASQSKSMFLATVSHE
LRTPLYGIIGNLDLLQTKELPKGVERLVTAMNNSSSLLLKIISDILDFSKIESEQLKIEP
SEFSPREVMNHISANYMPLVVRKQLGLYCFIEPDVPVTLLGDPMRLQQVISNLLSNAIKF
TDVGCIVLHVSRAGDYLSIRVRDTGTGIPAKEVVKLFDPFFQVGTGVQRNFQGTGLGLAI
CEQLISMMDGDISVDTEPGMGSQFTIRIPLYSAKYPVKAPAEGLSGKTCWLAVHNASLYA
FLESMLTNRGLRVVRYEGQSTDADDTLITDVDVDPSWQGRAAIIFCRRHIGIPQERVPGE
WTHSVATPHELMHLLAHIYRVEVDEHDGVNALPSPDSTVAMNDDMMILVVDDHPINRRLL
ADQLGSLGYQCLTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQLGLTLPVV
GVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTVYADRVRKSRV
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatacctcgtctcctttcgtaccacgcttaaagtctctcgctatctgtttcgggcg
ctggcgttattgctttggttgctggtcgcgctgttctcggtgttctatatcgttaacgcg
ctgcatcagaaggagtccgagatccgccaggagtttaacttaagctccgatcaggcccaa
cgctatattcagcgaacgtctgatgtgatgaaagagcttaagtacattgctgaaaaccgt
ctgacggcggaaaacggcattcttgccacgcgtgggcgggaagacaaatcagaagttccg
gactttgagcctttgttcccggattcagactgctcggcgatgggcaatgcgtggcgaggc
tctcttgagtcactgtcctggtttatgcgctactggcgcgataatttttctgctgcgtac
gaccttaaccgcgtgttcctcatcggcagcgaaaatctgtgtatggctgatttcggcctg
cgggatatgcccgttgagcgggaagatgcgctgaaaagtctgcacgagcgtattcttaaa
tatcgtaatgcgccccaggatgagcgcagcaataatatcttctggataagtcaggggccg
cgtccgggagtggggtacttctatgccctgacgccggtgtatctggccaatcgcctgcag
gcgctgctgggcactgagcagacgatccgcatggagaattttttcacgccgggcagctta
ccgatgggcgtgaccattctcgacgaaaatggtcataagctgatttccctgaccggaccg
gaagatcgtttgaaggtcgatccacgctggatgcaggaacgctcctggtttggctacacc
tcagggttccgtgatttggtgctgaagaaaagcctgccaccgtcctccctgagcatcgtc
tattccgtaccggttgatatggtgctggaacgtattcggatgctgatcctcaattccatc
ttactgaatgtgctggtgggcattgcgttgtttacgctggcgcgaatgtatgagcgtaag
attttcattccggcggaaaatgacgcccagcgactggaagagcacgaacagtttaaccgc
aaaattgtggcctctgcgcctgtcggtatctgtatcctgcgtactcaggacgggacaaat
atcctcagtaatgagctggcgcataactatctgaacatgctgacgcatgaggacaggcag
cggctgacgcagattatctgcggtcagcaggtgaattttgtcgatgtgttaaccagcaat
cacactaatctgcaaatcagttttgtacattcccgctatcgcaacgaaaacgtggcgatt
tgcgtgctggtggatgtctcctcgcgcgtgaaaatggaagagtcgttgcaggagatggcg
caggcggcggagcaggccagccagtcgaagtcgatgttccttgcgaccgttagccatgaa
ttgcgtacaccgctttacggtattatcggcaacctcgatctgctgcaaaccaaagagtta
ccgaagggcgttgagcgcctggtgaccgcgatgaataactcatcaagcctgttgttgaaa
atcattagcgacattctcgacttctctaaaattgaatctgagcagctgaaaatcgagccg
agcgaattttctccgcgtgaggttatgaaccacatcagcgccaactatatgccgctggtg
gtgcgtaaacagctcggcctttactgctttatcgagcctgatgtgccggtaacgctgctt
ggcgacccgatgcgcctgcagcaagttatttcgaacctgctcagtaacgccatcaaattt
accgatgtgggttgtatcgtactgcacgtttcccgcgccggagattatctgagcattcgt
gtccgtgatacgggaacgggtatcccggcaaaagaggtggtaaaactgttcgatccattc
ttccaggtggggaccggcgttcagcgtaacttccagggaacggggctggggctggcaatt
tgcgagcagttgatcagcatgatggacggcgatatttctgtggataccgaaccgggcatg
ggcagtcagttcacgattcgtataccgctctactcggcaaaatatccagtgaaagcacca
gcggaaggcttgagcggcaaaacctgctggctggcagtccataacgcttcgctgtatgcc
ttcctggaatcaatgctgacgaacaggggtcttcgcgttgtgcgctacgaagggcaaagc
acggatgcagacgatacattgattacggatgtggacgttgacccatcgtggcagggcaga
gccgccatcatcttctgtcgccgtcatattggtattccgcaagagcgtgtgccgggagag
tggacgcatagcgtcgcaacgccgcatgagctgatgcacctgctggcgcatatttatcgc
gtggaagtggacgagcacgacggcgttaacgcgctaccgtcgccggactcaacggtggca
atgaatgacgatatgatgattctggttgtggacgatcacccgatcaaccgccgtctgctt
gccgatcagctcggatcgctgggatatcaatgcctgacggccaatgacggtgtggacgcc
ctcaatgtgctgagcaaaaatcacatcgatattgtgcttagcgacgtgaatatgccgaat
atggacggctatcgtctgacgcagcgtattcgtcagttgggcctgacgctgccggttgtc
ggcgtgacggcgaatgcgctggcggaagagaaacagcgctgtctggagtcgggcatggac
agctgcctgtcgaaaccggtgacgttggatgtgattaaacagacgctgacggtgtatgcc
gatcgcgtcaggaaatccagggtataa

DBGET integrated database retrieval system