KEGG   Lelliottia jeotgali: LJPFL01_3366Help
Entry
LJPFL01_3366      CDS       T05035                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lef  Lelliottia jeotgali
Pathway
lef00071  Fatty acid degradation
lef00280  Valine, leucine and isoleucine degradation
lef00310  Lysine degradation
lef00362  Benzoate degradation
lef00380  Tryptophan metabolism
lef00620  Pyruvate metabolism
lef00630  Glyoxylate and dicarboxylate metabolism
lef00640  Propanoate metabolism
lef00650  Butanoate metabolism
lef00900  Terpenoid backbone biosynthesis
lef01100  Metabolic pathways
lef01110  Biosynthesis of secondary metabolites
lef01120  Microbial metabolism in diverse environments
lef01130  Biosynthesis of antibiotics
lef01200  Carbon metabolism
lef01212  Fatty acid metabolism
lef02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LJPFL01_3366
   00630 Glyoxylate and dicarboxylate metabolism
    LJPFL01_3366
   00640 Propanoate metabolism
    LJPFL01_3366
   00650 Butanoate metabolism
    LJPFL01_3366
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LJPFL01_3366
   00072 Synthesis and degradation of ketone bodies
    LJPFL01_3366
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LJPFL01_3366
   00310 Lysine degradation
    LJPFL01_3366
   00380 Tryptophan metabolism
    LJPFL01_3366
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LJPFL01_3366
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LJPFL01_3366
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LJPFL01_3366
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lef04147]
    LJPFL01_3366
Enzymes [BR:lef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LJPFL01_3366
Exosome [BR:lef04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LJPFL01_3366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ASV56729
UniProt: A0A248T2X4
Position
complement(3612609..3613787)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVELGSVVVKALVERSGIAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVIIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRNEIVPVNTLRNNGELLIVDTDEQPRTDASAEGLAKLNPAFEMLG
SVTAGNASSINDGAAAVLMMSESKAEELNLPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWQLSEVDLIEVNEAFAAQAISVGKMLEWDPSRVNVNGGAIALGHPIGASGCRILV
SLVHEMTKRNARRGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtgatagtgggtgcgttgcgtacggctatcggctgttttcagggggct
ttggcacgccactcggcggtggaactggggagcgtggtcgtaaaagccctggtcgaacgc
agtggaattgccgcccatgaaatagatgaagtgatcctcggccaggtgctgacggcgggc
gccgggcaaaaccctgcgcgtcaggcggcgctgaaaggcgggctgccgaatacggtctcg
gcgatcaccatcaacgacgtctgcggttcgggactgaaagcgctgcatctggcgacgcag
gcgattcagtgcggagaggccgacgtgatcatcgccggcggccaggagaacatgagccgc
gcgccgcacgttctcaccgacagccgaactggcgcacagctcggtaacagccaactgctc
gacagtctggtacacgacggcctgtgggatgcgttcaacgattaccatatgggcgtgacg
gcggaaaatctggcgcgtgaatatggcatcagccgcgaattgcaggacgcctacgcgctc
agctctcagcaaaaagcacgcgccgcgatcgattccgggcgttttcgcaatgaaattgtc
ccggtgaatacgctgcgcaacaacggcgagctgttgattgtcgataccgatgaacagccg
cgcaccgacgccagtgcagaagggctggcgaagctcaatcccgcttttgaaatgctggga
tcggtgaccgccggtaacgcttcctcgatcaacgacggcgcggcggcggtattgatgatg
agcgaaagcaaagccgaagaactcaatcttccggtgctggcgcggattaaagcttttgcc
agcgttggagtcgatcctgccctgatggggatcgcacctgtctatgctacgcgtcgctgc
ctggaacgcgcgggctggcagcttagcgaagtggatctgatcgaagtgaatgaagccttt
gctgcgcaggcgatttcggtcgggaaaatgctggaatgggacccgagccgggtgaacgtc
aacggcggcgcgattgcgctcggccacccgattggtgcatccggttgccgtattttggtc
tctttggtgcatgaaatgaccaaacgtaacgcgcgcagaggattagcgacgctatgcatt
ggcggcgggcaaggcgtggcgttagccatcgaaagatag

DBGET integrated database retrieval system