KEGG   Leptospirillum sp. Group II: ABH19_13650Help
Entry
ABH19_13650       CDS       T04007                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
leg  Leptospirillum sp. Group II
Pathway
leg00564  Glycerophospholipid metabolism
leg01100  Metabolic pathways
leg01110  Biosynthesis of secondary metabolites
Module
leg_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:leg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ABH19_13650
Enzymes [BR:leg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     ABH19_13650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF4118
Motif
Other DBs
NCBI-ProteinID: AKS24948
UniProt: A0A0K0WRP2
Position
complement(2702968..2703621)
Genome map
AA seq 217 aa AA seqDB search
MRIAENHFKTPVVREGFPFVLLALGVFFLSLYFLGMPGLIAGVLPAFVLNFFRNPNRQVP
AGRGLIVSPADGKIVKAQKDPLTGRWKVSIFMNVFDVHVNRIPVTSVVRKVTYIPGKFVN
ADLDKASEHNERNTLLLQTDDGHEISMTQVAGLIARRILCYAEVSDRLPAGTTFGLIRFG
SRVDLDLPEKTILSVGMGERVKGGESILGTLPSEQSG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcgcagagaaccactttaagacccctgttgttcgggaaggttttccttttgtc
ttactggcccttggggttttttttctgtccctgtattttcttggaatgccgggattgatc
gcgggtgtgttgcctgcttttgttctgaatttttttcgaaatccgaatcgacaagtccct
gccggacgaggattgatcgtttctccggcagacggaaaaattgtcaaggcacagaaagat
cccctcacagggcgctggaaagtgtcaatttttatgaatgtttttgatgttcacgtcaac
aggatccccgtgacgtctgttgtccggaaagtgacttacattccgggaaagtttgtgaac
gcggatttggacaaagcgtccgaacacaatgagagaaacacccttctgcttcagacggac
gacggtcatgaaatatcgatgacccaggtggcgggtctgatcgcccgccgtatcctctgt
tatgcggaagtctccgaccggttgcctgcgggaaccacttttggcctgattcggtttgga
tcccgggtggatctggaccttccggaaaagacgattctgtcggtcggaatgggagagcgg
gtaaagggaggagagtcgattcttggaacactaccatcagaacaatccggttga

DBGET integrated database retrieval system