KEGG   Leclercia sp. LSNIH3: C3F35_03370Help
Entry
C3F35_03370       CDS       T05316                                 

Definition
(GenBank) bifunctional glucose-1-phosphatase/inositol phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
leh  Leclercia sp. LSNIH3
Pathway
leh00010  Glycolysis / Gluconeogenesis
leh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:leh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C3F35_03370
Enzymes [BR:leh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     C3F35_03370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AUY37884
Position
complement(673952..675193)
Genome map
AA seq 413 aa AA seqDB search
MRKALIAVAVTCSIGLSGGVQAQTAPEGYQLQQVLIMSRHNLRAPLANNGSVLEQSTPEK
WPEWDVPGGQLTTKGGVLEVYMGHYMREWLAEEGVVTAGECPTANSVYAYANSLQRTVAT
AQFFITGAFPGCDVPVHHQEQMGTMDPTFNPVITDNSPEFREKALQAMNNERQGMKLDES
YSLLEQMTDYKDSPSCKEKQVCSLTGAKDTYSAEYQKEPGVSGPLKVGNSLVDAFTLQYY
EGFPLDQVAWGEIKTDQQWRVLSQLKNGYQDSLFTSAEVARNVAKPLVKYIDNVLVTDQA
KAPKITLLVGHDSNIASLLKALDFKPYQLPGQYERTPIGGKIVFQRWHDKTGNRDLMKIE
YVYQSTEQLRNAQVLSLKAPAQRVTLALNGCPVDADGFCPIETFNTVLNTAAK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcactaatcgctgtcgccgtgacatgcagcatcggtctgtctggcggcgtc
caggcgcaaaccgcgccggaagggtatcagctgcaacaggttctgattatgagccgccat
aacctgcgtgcgccgctggccaataacggcagcgtgctggagcagtcaaccccggaaaaa
tggccggagtgggatgtgcctggcgggcagctcaccaccaaaggcggggtgctggaggtc
tatatgggccactacatgcgcgagtggctggcagaggagggcgtggtaaccgccggggag
tgcccgacggcgaacagcgtttatgcctacgccaacagcctgcaacgcacggtggcgacc
gcacagttcttcattaccggggccttcccgggctgcgatgtgccggtgcaccatcaggaa
caaatgggcaccatggatccgacctttaacccggttattaccgataactccccggaattc
cgcgagaaagcgctgcaggcaatgaacaacgagcgccaggggatgaagctcgacgagagc
tacagcctgttggagcagatgaccgactacaaggattcgccttcctgcaaagagaaacag
gtctgttccctgaccggggcgaaagacacttacagcgccgaataccagaaagagcctggc
gtctccggcccgctgaaggtgggtaactcgctggtggatgcctttaccctgcaatactac
gaaggcttcccgctggatcaggtggcgtggggcgagatcaaaaccgaccagcagtggcgg
gtgctgtctcagctgaaaaatggttatcaggactcgctgttcacctcggcagaggtggcg
cggaacgtggcgaaaccgctggtgaaatacattgataacgtgctggtcaccgaccaggcg
aaggcaccgaaaatcacgctgctggtggggcatgactcgaacatcgcctcgctgctgaaa
gccctcgatttcaagccttatcaactgcccggtcagtacgagcgcacgccgattggcggc
aagatcgttttccagcgctggcacgataagaccggcaaccgggatttgatgaaaattgag
tatgtttatcagagtacggagcagctacgtaatgcccaggtcctgtcgttaaaagccccg
gcgcagcgtgtcactctggcgctgaacggctgcccggtggatgcggacggcttctgcccg
atagagacatttaatacggtgctgaatacggcggcgaaataa

DBGET integrated database retrieval system