KEGG   Leclercia sp. LSNIH3: C3F35_08480Help
Entry
C3F35_08480       CDS       T05316                                 

Definition
(GenBank) multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
leh  Leclercia sp. LSNIH3
Pathway
leh00760  Nicotinate and nicotinamide metabolism
leh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:leh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    C3F35_08480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:leh03000]
    C3F35_08480
Enzymes [BR:leh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     C3F35_08480
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     C3F35_08480
Transcription factors [BR:leh03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    C3F35_08480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 HTH_26 Citrate_ly_lig CTP_transf_like HTH_35 HTH_37 MMR_HSR1 FAD_syn AAA_29 ABC_tran Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AUY38813
Position
complement(1754946..1756178)
Genome map
AA seq 410 aa AA seqDB search
MSSFDYIKTAIRQKGCTLQQVAEASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFP
RMQKNIGVVFGKFYPLHTGHVYLIQRACSQVDELHIIMGYDDKRDRELFEASAMSQQPTV
SDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKAFMEEKGIQPNWIYTSEE
SDASQYPEHLGTETVLIDPKRTFMNISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGHAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGMRSLG
SSVDRKEFQTMLLEMLEANNIDFVHVEEADYDGRFLRCVELVKEMMGEKG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcatttgactatatcaagaccgctatccgccaaaagggctgcaccttgcagcag
gtggcggaagccagcggtatgaccaaaggctatttaagccaactgctgaatgccaaaatc
aaaagccccagcgcgcagaagctggaagcgctgcatcgctttttggggcttgaatttccg
cgcatgcaaaagaacatcggcgtggtgttcggcaagttttatccgctgcataccgggcat
gtctacctcatccagcgcgcctgtagccaggtggacgaactgcatatcatcatgggctac
gatgataagcgcgaccgcgagctgttcgaagccagcgccatgtcccagcaacctaccgta
tccgatcgcctgcgctggttgctgcaaacctttaaataccagaaaaacattcgtattcat
gcctttaacgaagagggcatggagccgtatccccacggctgggacgtgtggagcaatggc
ataaaagcctttatggaagagaaagggattcagcctaactggatctatacctctgaagag
tccgatgcctcgcaatacccggaacacctgggaacggagacggtgctgattgaccccaaa
cgcacctttatgaacatcagcggagcgcagatccgcgaaaacccgttccgctattgggag
tacattcccaccgaagtgaagccgttctttgtgcgcaccgtggcgatcctcggcggggag
tccagcggtaaatccacgctggtcaacaagctggcgaacatctttaacaccaccagcgcc
tgggagtatggccgggattatgtcttctcacacctcggcggggatgagatggcgttgcag
tattccgactacgataaaatcgcgctgggccatgcgcaatacattgattttgcggttaaa
tacgctaataaagtggcgttcattgacaccgatttcgtcactactcaggcgttttgtaag
aagtacgaagggcgcgagcacccgtttgtgcaggccctgatcgacgaataccgctttgac
ctggtgatcctgctggagaacaacacgccgtgggtagcggatgggatgcgcagcctgggc
agctcggtggaccggaaagagttccagaccatgctgttggagatgctggaagcgaacaat
atcgactttgtgcatgtggaagaggcagattatgacggccgtttcttgcgttgcgtggag
ctggtgaaagagatgatgggggagaaggggtaa

DBGET integrated database retrieval system