KEGG   Leclercia sp. LSNIH3: C3F35_09440Help
Entry
C3F35_09440       CDS       T05316                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
leh  Leclercia sp. LSNIH3
Pathway
leh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:leh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C3F35_09440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:leh02000]
    C3F35_09440
Enzymes [BR:leh01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     C3F35_09440
Transporters [BR:leh02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    C3F35_09440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_22 AAA_30 RsgA_GTPase AAA_23 ABC_ATPase AAA_16 DUF2813 MMR_HSR1 AAA_13 AAA_15 TsaE FeoB_N DUF815 DLIC
Motif
Other DBs
NCBI-ProteinID: AUY38985
Position
complement(1950012..1951514)
Genome map
AA seq 500 aa AA seqDB search
MTTEQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGTIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPRRFGFLRRK
EMEARATRLMESYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
VEMLFTLMRQLRDQGVSLIFVTHFLDQVYEVSDRITVLRNGGFVGCRETRELPQIELVKM
MLGRELETNALQRAGRTLLSEKPIAAFKDYGKKGTIAPFNLEVRPGEIVGLAGLLGSGRT
ETAEVIFGIKPADTGTALIKGKPQALRSPHQASSLGIGFCPEDRKTDGIIAAASVRENII
LALQAQRGWLRPIPRKEQNAIAERFIRQLGIRTPSAEQPIEFLSGGNQQKVLLSRWLLTK
PQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRQQ
VAEIPLDGLSVPAIMNAIAA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgaacaacaccaggaaatcctccgcacagagggcttaagcaaattcttcccc
ggcgtaaaagcgctggataacgtcgattttagcctacggcgcggcgagatcatggccctt
cttggggaaaacggcgcggggaaatccacgctgattaaagccctgaccggcgtgtatcac
gccgatcgcggcactatctggctggaaggccaggccatttcgccaaaaaataccgcccat
gcccagcagctgggaatcgggacggtctatcaggaagtgaacctgctgccgaacatgtcg
gtcgctgataacctgtttatcggtcgcgagccgcggcgttttggctttttgcgtcgcaaa
gagatggaagcccgcgccacccggctgatggaatcctacggcttttccctcgacgtgcgc
gaaccgttgaaccgtttttcggtggcgatgcagcagatcgtcgctatctgccgcgctatc
gatctctctgccaaagtgctgatcctcgatgaacccaccgccagcctggatacccaggag
gtggagatgctcttcaccctgatgcgtcagctgcgcgatcagggggtgagcctgattttt
gtcacccacttcctcgatcaggtctacgaagtgagcgaccgcattaccgtgctgcgtaat
ggcggctttgttggctgtcgcgaaacccgcgagctgccgcaaatcgagctggtgaaaatg
atgcttggccgcgagctggagaccaacgccctccagcgtgcgggccggacgctgctaagt
gaaaagcccattgcggcgttcaaggattacggcaagaaaggcaccattgcgccgtttaac
ctggaagtccgccctggcgagatcgtcggcctggcggggctgttgggttcaggccgtacc
gaaaccgcagaggtgatcttcggcattaaaccagccgacaccggcactgcgctgatcaaa
ggcaaaccccaggcgctgcgttcgccgcatcaggcctccagcctcgggatcggcttctgc
ccggaagatcgcaaaaccgacgggattattgccgcggcctccgtgcgtgaaaacatcatt
ctggccctgcaagcccagcgcggctggctgcggccaatcccgcgtaaagagcagaacgct
attgccgagcgctttattcgccagctggggatccgcaccccgagcgccgaacagcccatc
gaatttctctcgggcggcaaccagcagaaggtgctgctgtcgcgctggctcctgaccaaa
ccgcagttcctgatcctcgacgagccgacacggggcatcgacgtgggggcgcatgcggag
atcatccgcctgatcgaaacgctctgcgccgacggcctggcgctgctggtgatctcctcg
gaactggaggagctggtgggctatgccgatcgcgtgatcatcatgcgtgaccggcagcag
gtggccgagatcccgctggacgggctgtccgttccggcaatcatgaacgccattgcggca
taa

DBGET integrated database retrieval system