KEGG   Leclercia sp. LSNIH3: C3F35_19145Help
Entry
C3F35_19145       CDS       T05316                                 

Definition
(GenBank) two-component system sensor histidine kinase RcsC
  KO
K07677  two-component system, NarL family, capsular synthesis sensor histidine kinase RcsC [EC:2.7.13.3]
Organism
leh  Leclercia sp. LSNIH3
Pathway
leh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:leh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C3F35_19145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:leh01001]
    C3F35_19145
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:leh02022]
    C3F35_19145
Enzymes [BR:leh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     C3F35_19145
Protein kinases [BR:leh01001]
 Histidine kinases
  NarL family
   C3F35_19145
Two-component system [BR:leh02022]
 NarL family
  RcsC-RcsD-RcsB (capsule synthesis)
   C3F35_19145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsC Response_reg HATPase_c HisKA HTH_45
Motif
Other DBs
NCBI-ProteinID: AUY40721
Position
3945694..3948540
Genome map
AA seq 948 aa AA seqDB search
MKYLVSFRTTLKVSRYLFRALALLIWVLIALFSVFYIVNALHQKESEIRQEFNLSYEQSQ
RYIQRTADVMKELKYIAENRLTAENGVLATRGRDSKTEVPNFEPLFPDSDCSVMGPAWRG
SLASLAWFMRYWRDNFSAAYDLNRVFLIGSENLCMANFGLRDVPVDRENALKSLRERITK
YRNAPQDERGNNLFWIGQGPRPGVGYFYAMTPVYLANRLQAMLGTEQTIRMENFFTPGNL
PMGVTILDENGHSLISLAGPETRLKVDPRWMQERSWFGYTSGFRDLVLKKSLPPSSLSIV
YSVPVDLVLERIRMLILNSVLLNVLVGIALFTLARMYERKIFIPAEIDAQRLEEHEQFNR
KIVASAPVGICILRTLDGTNILSNELAHNYLNMLTHEDRQRLTQIICGQQVNFVDVLTSN
NTNLQISFVHSRYRNENVAICVLVDVSARVKMEESLQDMAQSAEQASQSKSMFLATVSHE
LRTPLYGIIGNLDLLQTKELPRGVDRLVTAMNNSSSLLLKIISDILDFSKIESEQLKIEP
REFSPREVMNHISANYLPLVVRKQLGLYCFIEPDVPVSLQGDPMRLQQVISNLLSNAIKF
TDMGCIVMHVSRAGDYLSIRVRDTGVGIPAKEVVKLFDPFFQVGTGVQRNFQGTGLGLAI
CEKLISMMDGDISVDTEPGMGSQFTIRIPLYAAQSPANVLVEGLSDKRCWLAVNNASLYA
YLESLLTTHGIRVARYTGQTPDAEDMLITDDELTQPWQGKAAVIFCRRHIGIAQERAHGE
WVNSVASPHELITLLARIYRVEMETADGTTALPSPESVQSMNEDMMILVVDDHPINRRLL
ADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQLGLTLPVV
GVTANALAEEKQRCLESGMDSCLSKPVTLDVLKQTLSVYAERVRKTRV
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatacctcgtctcctttcgaaccacgctgaaagtttctcgctatctgttccgggcg
ctggcgctcctgatttgggtgttgatcgccctgttttcggtgttttacatcgtcaatgcg
ctgcaccagaaggagtcggagatccgccaggagttcaaccttagctacgaacagtcccag
cgctacattcagcgcaccgcagacgtcatgaaggaactcaagtacatcgcggagaaccgg
ctgacggcagaaaacggcgtactggccacccgcggacgcgacagtaaaaccgaggtgccc
aactttgagccgctgttccccgattctgactgttctgttatggggccggcatggcggggt
tcgctggcgtcactggcctggtttatgcgctactggcgcgataacttctcggcagcgtac
gatctgaaccgggtctttctgattggcagcgaaaatctctgtatggccaattttggcctg
cgtgacgtgccggtcgatcgcgaaaacgccctgaaaagcctacgcgaacggatcaccaaa
taccgcaacgcaccgcaggatgagcgcggcaacaacctgttctggattggccaggggccg
cgtccaggggtagggtacttctatgccatgacgccggtctatctggcgaaccgcctgcag
gcgatgctcggtactgaacagactatccgcatggagaactttttcactcccggcaatctg
ccgatgggcgtaaccattctcgatgaaaatggccacagccttatctcgctggcggggcca
gaaacacgtctcaaggttgaccctcgctggatgcaggagcgttcatggtttggctatacc
tccggtttccgcgatctggtgctgaaaaagagcctgccgccatcgtccctgagcatcgtc
tattccgttccggtggatctggtcctggaacgtatccgcatgctgatcctcaactcggtg
ctactcaacgtgctggtggggattgcgctgtttaccctggcgcggatgtacgagcgcaaa
atatttatcccggcggagatcgatgctcagcgcctcgaggagcatgagcagttcaaccgc
aagattgtcgcctctgcgccggtggggatctgtattctgcgcaccctggatgggactaac
atcctcagtaacgagctggcgcataactatctcaatatgctgacccacgaggatcggcag
cggctgacgcagattatctgcggacagcaggtcaactttgtcgacgtgctcaccagcaac
aacaccaatttgcagattagctttgtgcactcgcgctatcgcaacgagaacgtcgccatc
tgcgtgctggtggatgtctccgcacgcgtcaaaatggaagagtcgttgcaggacatggcc
cagtcggctgaacaggccagccagtccaaatcgatgttccttgcgacggtcagccacgag
ttgcgcaccccgctgtacggtattattggtaacctcgatctgctgcagaccaaagagctg
ccccggggcgtagaccgtctggtgacggcgatgaataactcctccagcctgctattgaaa
atcatcagcgatattctcgacttctccaaaattgagtccgagcagctgaaaattgagccg
cgcgaattctcaccgcgcgaggtgatgaaccatatcagcgccaactacctgccgctggtg
gtacgtaagcagttgggactgtactgctttattgagccggacgtgccggtatcgctgcag
ggcgatccgatgcgcctgcagcaggtgatctccaacctgctcagcaacgccattaaattt
accgacatgggctgcattgtgatgcatgtctccagggcaggggactatctgagcattcgc
gtgcgcgacaccggggtcggtattccggccaaagaggtggtcaaactcttcgatccgttc
ttccaggtggggaccggggttcagcgcaatttccagggcaccggtctggggctggcgatc
tgtgaaaaactgatcagcatgatggatggcgatatctcggtggataccgaacccggtatg
ggtagccagttcaccattcgcattccgctgtatgccgcgcagtctccggccaacgtgctg
gtagagggattaagtgataaacgctgttggttagcggtcaataatgcctcgctgtatgcc
tatctggaatccctgctgacgacacacggtattcgcgtggcacgctacacaggccaaacg
ccggacgcagaagacatgctcatcaccgacgatgaactgacgcagccgtggcagggtaaa
gcggcagtgatcttctgccgtcgccatattggcattgcccaggagcgtgcccacggtgaa
tgggtaaacagcgtggcctcgccgcacgaactgattacgctgctggcgcggatctaccgt
gtggagatggagacagccgacggcacgacggcgctaccgtcaccggaatcggtgcagtcg
atgaatgaagacatgatgatcctggtggtggatgaccatccgattaaccgccgcctgctg
gctgaccagcttggctcgctgggctatcagtgcaagaccgcgaacgatggtgtggatgcg
ctgaatgtgctgagtaaaaaccatatcgacatcgtcctgagcgacgtgaacatgccgaac
atggatggctatcgcctgacccaacgcattcgccagctggggctgacgctgccggtggtg
ggcgtcaccgctaacgccctggcggaagagaaacagcgctgtctggagtcggggatggac
agctgtctttccaagccggtaacgctggacgtgctgaaacagacgctgtcggtgtacgcg
gagcgggtgaggaaaacgcgagtataa

DBGET integrated database retrieval system