KEGG   Leclercia sp. LSNIH1: C2U54_02675Help
Entry
C2U54_02675       CDS       T05297                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lei  Leclercia sp. LSNIH1
Pathway
lei03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lei00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C2U54_02675 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lei03011]
    C2U54_02675 (rplV)
Ribosome [BR:lei03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C2U54_02675 (rplV)
  Bacteria
    C2U54_02675 (rplV)
  Archaea
    C2U54_02675 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AUU82984
UniProt: A0A2I8NNM4
Position
complement(497642..497974)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgctcagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggccctggatattctgacctacaccaat
aagaaagcggctgtactggtcaagaaagttctggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgacgatctgaaagttgcgaaaattttcgtagacgaaggcccg
agcatgaagcgcattatgccgcgtgcgaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system