KEGG   Leclercia sp. LSNIH1: C2U54_08535Help
Entry
C2U54_08535       CDS       T05297                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
lei  Leclercia sp. LSNIH1
Brite
KEGG Orthology (KO) [BR:lei00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C2U54_08535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AUU84052
UniProt: A0A2I8NQQ6
Position
complement(1696577..1696954)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCVQVQSLYIESQSTPDEERFVFAYTVTIRNLGRTPVQLLGRYWLITNGNGREI
EVQGEGVVGEQPHIAPGEEYQYTSGAVIETPLGTMQGHYEMVDTEGNAFRVAIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaattcgccccgcgtatgtgttcaggtgcaaagcctttacatcgagtctcaatcc
acaccggatgaagaacgttttgtttttgcttacaccgtgaccattcgcaatctcgggcga
acccctgtccagctgctggggcgttactggcttatcactaacggcaatggccgtgaaatt
gaagtgcagggcgaaggtgtggtgggtgaacagccgcacattgcgcccggcgaagagtat
cagtataccagcggtgcagtaatcgagacgccgctgggaaccatgcagggccattatgaa
atggtcgataccgagggcaatgcattccgcgttgccattcctgttttccgtctggctgta
ccaacactcattcactaa

DBGET integrated database retrieval system