KEGG   Leclercia sp. LSNIH1: C2U54_14495Help
Entry
C2U54_14495       CDS       T05297                                 

Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
lei  Leclercia sp. LSNIH1
Pathway
lei00450  Selenocompound metabolism
lei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C2U54_14495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lei03016]
    C2U54_14495
Enzymes [BR:lei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     C2U54_14495
Transfer RNA biogenesis [BR:lei03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    C2U54_14495
 Prokaryotic Type
    C2U54_14495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AUU85141
UniProt: A0A2I8NTT0
Position
2914529..2915572
Genome map
AA seq 347 aa AA seqDB search
MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFIDPNLLVGNETRDDAAVYDLGNG
TSIISTTDFFMPIVDNPYDFGRIAATNAISDIFAMGGKPIMAIAILGWPINTLAPEIARE
VIEGGRFACQQAGIALAGGHSIDAPEPIFGLAVTGVVPTERVKRNSTAEAGCKLFLTKPL
GIGVLTTAEKKSLLLPEHKGLATEVMCQMNLAGAAFADIEGVKAMTDVTGFGLLGHLSEV
CQGAGVQAQVWYHEVPKLPGVEAYIAQGAVPGGTQRNFASYGHLMGEMPAEWRDLLCDPQ
TSGGLLLAVTPDAEEAVRATAAEFGITLTAIGELVTARGGRPMIEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaagctattcgtttaacgcaatacagccatggagccggttgcggttgtaaa
atttcccccaaagtgctggaaaccattctgcacagcgagcaggcgaagtttatcgacccg
aacctgcttgttggcaatgaaacccgcgatgatgctgccgtctacgatctgggtaacggc
accagcattatcagcaccaccgatttctttatgccgatcgtcgacaatccctacgatttc
gggcgcattgcggccacgaacgccatcagcgacatttttgcaatgggcggcaagccgatc
atggcgattgcgatccttggctggccgattaacaccctggccccggagatcgcccgcgag
gtgatcgagggtgggcgtttcgcctgccagcaggcggggatcgccctggcgggtggccac
tccattgatgccccggagccgatttttggcctggcggtgaccggcgtggtgccaacggag
cgcgtcaagcgtaacagcaccgcggaagccggctgcaagctgttcctcaccaagccgctg
ggcattggcgtgctcaccaccgccgagaaaaaatcgctgctgttgcctgagcacaaaggg
ctggcaacagaggtgatgtgccagatgaaccttgccggtgctgcctttgccgacatcgag
ggggtgaaggcgatgaccgacgtcaccggttttggcctgctgggccacctgagcgaagtg
tgccagggcgcaggcgttcaggcgcaggtctggtatcacgaggtaccgaagctgccgggc
gtggaagcctacattgcgcaaggcgcggtcccgggcggcacgcagcgtaacttcgccagc
tacggccatctgatgggcgagatgcctgccgagtggcgcgatctgctgtgcgacccgcag
acctccggcggcctgctgctggccgtgacgccagacgccgaagaggcagtgcgcgcgacc
gccgccgagttcggtattaccctgaccgccattggcgagctggtgaccgcccgcggtggc
cgtccgatgattgagatccgttaa

DBGET integrated database retrieval system