KEGG   Leclercia sp. LSNIH1: C2U54_20540Help
Entry
C2U54_20540       CDS       T05297                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
lei  Leclercia sp. LSNIH1
Pathway
lei00020  Citrate cycle (TCA cycle)
lei00620  Pyruvate metabolism
lei01100  Metabolic pathways
lei01110  Biosynthesis of secondary metabolites
lei01120  Microbial metabolism in diverse environments
lei01130  Biosynthesis of antibiotics
lei01200  Carbon metabolism
Module
lei_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lei_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2U54_20540 (mqo)
   00620 Pyruvate metabolism
    C2U54_20540 (mqo)
Enzymes [BR:lei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     C2U54_20540 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 AnmK
Motif
Other DBs
NCBI-ProteinID: AUU86255
UniProt: A0A2I8NX06
Position
complement(4155735..4157390)
Genome map
AA seq 551 aa AA seqDB search
MKKMTALLLAAAASLSAVSTAAKAQASQEQETDVLLIGGGIMSATLGTYLQELQPDWSMT
MVERLDGVAQESSNGWNNAGTGHSALMELNYTPQKKDGSISIEKAVEINEAFQISRQFWS
HQVNSGVLHDPHSFINTVPHMSFVWGDDNVNFLRGRYAALQQSSLFRGMKYSEDHAQIKE
WAPLVMEGRDPNQKVAATRTEIGTDVNYGEITRQLVGSLQKKENFTLSLNTEVRGFKRNA
DNSWSVTVADLKHNEEEHVIKAKFVFIGAGGAALKLLQETGIPEAENYAGFPVGGQFLVS
ENPEVVNRHLAKVYGQASVGAPPMSVPHIDTRVLDGKSVVLFGPFATFSTKFLKNGSLWD
LLSSTTTSNVGPMVDVGLDNFDLVKYLISQVMLSDDDRFAALKEYYPEAKKADWRLWQAG
QRVQIIKRDEEKGGVLRLGTEVVSDKEGTVAALLGASPGASTAAPIMLHLMEKVFKDKVA
SPEWQAKLKTIIPSYGTALNGNVEATEQELEYTSRVLQLKYEKPQAPDAAPQPEAQATSQ
PESKPVADIAL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgactgccctgctgctggctgcggcggcaagccttagtgctgtctccacg
gcggcgaaggctcaggcatcgcaagagcaggaaacggacgttctgttaattggtggcggg
atcatgagcgccacgctgggaacctatttgcaggagcttcagccggactggtccatgacc
atggttgaacgcctggacggggtagcgcaggagagctctaacggctggaacaacgccggg
accggccactccgcgttaatggagctgaactacaccccacagaagaaagatggctccatc
agcattgagaaagcggtggagatcaacgaagcgtttcagatctctcgtcagttctggtct
caccaggtgaacagcggtgtgctgcacgatccacacagtttcattaacaccgtcccgcac
atgagctttgtctggggagacgacaatgtgaacttcctgcgcggacgttatgctgctctg
cagcaaagctcgctgttccgcggcatgaagtactccgaagatcacgcccagatcaaagag
tgggcgccgctggtgatggaagggcgcgacccgaaccagaaggtggcggccacccgtacg
gaaatcggtaccgacgttaactatggcgaaattacccgtcagctggtgggctctctgcag
aaaaaagagaactttacgctgtcgctgaataccgaagtgcgcggctttaagcgcaacgcg
gacaactcctggagcgtgaccgtcgccgatctgaagcacaatgaagaagagcacgtcatt
aaggcgaagtttgtctttatcggtgcgggcggcgcggcgctgaagctgctgcaggagacc
ggtattccggaagcggagaattacgcgggcttcccggttggcggccagttcctggtgtcg
gaaaacccggaggtggtgaatcgccatctggcgaaggtctatggtcaggcgtccgtgggc
gcaccgccgatgtcggtgccgcatatcgatacacgtgttctcgacggtaagagcgtggtg
ctgttcgggccgttcgccaccttctcgaccaaattcctgaagaacggttcgctgtgggat
ctgctcagctccaccaccacttcaaacgtgggtccgatggttgatgttggtctggataac
ttcgatctggtgaaatacctgattagccaggtgatgctctccgatgacgatcgctttgcg
gcgctgaaagagtactatccggaagcgaagaaagcggactggcggttgtggcaggcgggc
cagcgcgtgcagatcatcaagcgtgatgaggaaaaaggcggcgtgctgcgtctgggcact
gaagtggtcagtgataaagaaggcactgtagccgcgctgctgggagcctccccgggcgcc
tccaccgcggcaccgattatgctgcacctgatggaaaaagtgtttaaagacaaagtcgcc
agcccggagtggcaggcgaagctgaagaccattattccttcatacggtacggcgctgaac
ggcaacgttgaggccaccgagcaggagctggagtacaccagccgcgtgctgcagctgaag
tatgaaaaaccgcaggcaccggatgcggcgcctcagcctgaggcgcaggcgacctcccag
ccggaaagcaaaccggttgcggatatcgcactctga

DBGET integrated database retrieval system