KEGG   Leclercia sp. LSNIH1: C2U54_25730Help
Entry
C2U54_25730       CDS       T05297                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
lei  Leclercia sp. LSNIH1
Pathway
lei00625  Chloroalkane and chloroalkene degradation
lei00680  Methane metabolism
lei01100  Metabolic pathways
lei01120  Microbial metabolism in diverse environments
lei01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lei00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    C2U54_25730
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C2U54_25730
Enzymes [BR:lei01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     C2U54_25730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AUU87335
UniProt: A0A2I8P054
Position
pLEC-1cb1:117085..118218
Genome map
AA seq 377 aa AA seqDB search
MKAVIYNGPYDVKVKDVPDAKIVRPTDVLVRITTTNICGSDLHMYEGRTSFEQGRILGHE
NLGEVVEIGSGVERIKVGDYVCLPFNVGCGFCENCEKGLTGFCLTTNPGTAGAAYGFAEM
GPWEGGQAELLRVPFADFNCLVLPPDAAEKEDDYVMLSDIFPTGWHATELAGLKPGESVA
IYGAGPVGLMAAHSAIIKGASQVFVVDTHTDRLALAEKMGATGINATGDEAVQKILDLTD
GRGTDCGCECVGYQCCNKHGHEDNSVTMNSLVASTKATGGIGVVGVFIPQDPGAESELAR
EGKMPFDFGSFWFKGQAIRTGQANVKAYNRQLSRLIHHDKASPGKIISHRLSLEEAPAGY
KHFDERDEGWTKVILKP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtaatttacaacggtccttatgatgtaaaagtaaaagacgtaccggatgcg
aaaattgtccgccccacggatgtactcgtccgcatcaccaccaccaacatttgtgggtcg
gacttgcacatgtatgagggccggaccagctttgaacagggacggattctgggtcacgaa
aacctgggtgaagtggtcgaaattggctcaggcgttgaacgtattaaggtgggcgactat
gtttgtctgccgtttaacgtgggatgtggtttttgcgaaaactgtgaaaaaggtctgacc
ggcttttgtctcactaccaatccgggtacggcaggcgcagcttatggttttgctgaaatg
ggtccctgggagggaggtcaggcggaacttcttcgggtgccatttgccgactttaactgc
cttgttcttccccctgatgcggcagaaaaagaagatgattatgtgatgctctctgacatt
tttcctaccggctggcatgcaacagaacttgccggattgaagcctggtgaaagcgtggcc
atttatggcgcggggccggtcggtttgatggcagctcattcggcgatcattaaaggtgct
tcacaggtgtttgtggttgatacgcacacagaccggttggctctggctgaaaaaatgggg
gcgacgggcatcaatgctactggcgatgaagctgtacaaaaaattctcgacctgacggat
ggacgcggtacggattgtggctgcgaatgtgttggctatcagtgctgtaacaaacatggc
catgaagataactctgttaccatgaacagtcttgttgcgtcgacgaaagcaaccggggga
attggtgtggttggcgtctttattcctcaggatccgggggctgaatcggagcttgccaga
gagggtaagatgccatttgattttgggagtttctggtttaaaggacaggcaatccgtacc
ggccaggcgaacgttaaggcctataaccgtcagctgtctcgcctcatccatcacgataaa
gccagtccgggcaaaataatttctcatcgtctttcgcttgaagaggctcctgccggatat
aagcacttcgatgagcgggatgaaggatggacgaaggttatccttaagccttaa

DBGET integrated database retrieval system