KEGG   Leisingera sp. NJS204: ETW24_18115Help
Entry
ETW24_18115       CDS       T05817                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
lej  Leisingera sp. NJS204
Pathway
lej00350  Tyrosine metabolism
lej00360  Phenylalanine metabolism
lej00380  Tryptophan metabolism
lej01100  Metabolic pathways
lej01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lej00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ETW24_18115
   00360 Phenylalanine metabolism
    ETW24_18115
   00380 Tryptophan metabolism
    ETW24_18115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lej04147]
    ETW24_18115
Enzymes [BR:lej01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     ETW24_18115
    4.1.1.105  L-tryptophan decarboxylase
     ETW24_18115
Exosome [BR:lej04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETW24_18115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC MoCF_biosynth Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: QAX31133
UniProt: A0A481PPL4
Position
3728782..3730194
Genome map
AA seq 470 aa AA seqDB search
MKWDEFSEWGRRVADWTQDYHLTVGDRPVRARTEPGQVLNALPQTPPEGGEGMEMIFRDF
EDIVMPGITHWQHPRFFAYFTSNAAAPSVLAEFLASAIAPQCMLWQTSPAATEMETRMMD
WLRQALDLPDQFRGVIQDSASSATLAAVLTMREKALNWQGNSQGLFGQKALRIYCSSEVH
TSIDRAIWVAGIGQQNLIRIPIKGDWRGMDPDALEAAIQSDLAAGHQPAGVILCVGGTGV
GATDPVDKVLNVAQKYSLYTHVDAAWAGSAMICPEYRHYWPGVERADSIVFNPHKWLGVQ
FDCSAHFLKNPDDLVQTLAISPEYLKTHGHDGIINYSEWSVPLGRRFRALKIWFLIRTYG
LEGLRQRLRNHITWSNQLHKKLKLEPDFQITTPPMWSLWSFRYSPEGAADLDELNLALVN
AINDDGRIYLTQTRLDGQLVIRFQAGQFETTEADVMMVFDVITEIARSLQ
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgggatgaattctccgaatggggccgccgggtcgcggattggacgcaggattac
cacctcactgtcggcgaccgcccggtgcgggcccgaaccgagcccggccaagtgctgaac
gccctgccccaaaccccgcctgagggtggcgaggggatggagatgatcttccgcgatttc
gaggatatcgtgatgcccggcatcacccactggcagcacccccgcttctttgcctatttc
acctccaacgccgccgcgccttcggtactggcggaattcctcgcctccgccatcgcgccc
caatgcatgctgtggcagacctctccggcagcgaccgaaatggaaacccggatgatggac
tggctgcgccaagcgctggacctgccggaccagttcaggggcgtcattcaggactccgcc
tcttccgccactcttgccgccgtcctgaccatgcgggaaaaagcgctgaactggcagggc
aacagccagggcctgttcggtcagaaagcgctgcgcatctactgctcgtcggaggtccac
acctccatcgaccgcgccatctgggtcgccggcataggccagcagaacctgatccgcatc
cccatcaagggcgactggcgcggcatggacccggacgcgctggaggccgccatccaatcc
gacctcgccgcaggacaccagcccgccggcgtcatcctctgcgttggcggcaccggcgtt
ggtgccactgaccctgtcgacaaggtgctgaatgtagcccaaaaatacagcctctacacc
catgtcgacgccgcctgggccggctccgccatgatctgccccgaataccgccactactgg
ccgggggtggagcgcgccgacagtatcgtcttcaacccgcataaatggctgggggtgcaa
ttcgactgctccgcccatttcctgaagaacccggatgacctggtgcaaaccctggcgatc
agcccggaatacctcaagactcacggccatgacggcatcatcaactattccgaatggtcg
gtgccgctgggccgccgcttccgcgctctcaagatctggttcctgatccgcacctacggg
cttgagggcctgcgccagcgcctgcgcaaccacatcacctggtccaaccagttgcacaaa
aaactcaagttagagccggattttcagatcaccaccccgccaatgtggtcgctctggtcc
ttccgctattcgcctgaaggcgcagcagacctcgacgaactgaacctcgcattggtcaat
gccatcaacgacgacggccgcatctacctgacccagacccgcctcgacggtcagctggtg
atccgcttccaggcgggccagtttgaaaccaccgaagcagacgtgatgatggtcttcgat
gttatcaccgaaatcgcgaggagcctgcagtga

DBGET integrated database retrieval system