KEGG   Leisingera sp. NJS204: ETW24_22845Help
Entry
ETW24_22845       CDS       T05817                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
lej  Leisingera sp. NJS204
Pathway
lej00360  Phenylalanine metabolism
lej00362  Benzoate degradation
lej00621  Dioxin degradation
lej00622  Xylene degradation
lej01100  Metabolic pathways
lej01120  Microbial metabolism in diverse environments
lej01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lej00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    ETW24_22845 (dmpG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ETW24_22845 (dmpG)
   00622 Xylene degradation
    ETW24_22845 (dmpG)
   00621 Dioxin degradation
    ETW24_22845 (dmpG)
Enzymes [BR:lej01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     ETW24_22845 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm HTH_23
Motif
Other DBs
NCBI-ProteinID: QAX32228
UniProt: A0A481PSH7
Position
unnamed4:97860..98900
Genome map
AA seq 346 aa AA seqDB search
MAIAIHDPTLRDGNHAIAHTLSLDDIAAYCRTVDGCGLDVVEVGHGNGLGASSLQLGMAR
HADREMLETARANLNCTKLGIHAIPGFAKISDIRSAIDAGVDVFRIAAHCTEGDLTQSYI
EYARSQDKYVQGVLMMTHMAPAEVLLAQAQRQVSYGANAIVLMDSAGNYDPRDTSEKIGM
LAAELDVPVGFHAHNNLGLAIANSVAAAEAGATILDGTMRGFGAGAGNTQLEVLCAVLER
YGFETGTDVFALCEAVEALPELPPVQRRTIVGTSNLISGIYGVCAGFEKHVTRAAQDFGV
APRYIYEELSRCNAVAGQEDLIISAAAHLSKTPPETSAQPRKGVTA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggccattgccattcacgacccgactctgcgcgacggtaaccacgccattgcccacaca
ctcagccttgatgatatcgccgcctattgccggaccgttgatggctgcgggctggatgtg
gtcgaggttggacatggcaacgggctgggggcatcctccctgcagctgggcatggcgcgc
catgcagaccgcgagatgctggaaacggcccgcgccaatctgaactgcaccaagctgggc
attcatgcgatccccggtttcgcaaagatttccgacatcagatcggccattgatgccggt
gttgatgtgttccgcattgccgcgcattgtaccgagggcgatctgacccaaagctatatc
gaatatgcccgcagccaggacaaatatgtgcagggcgtgctgatgatgacccatatggcg
cctgcggaggtgctgctggcgcaggcgcagcgtcaggtctcctatggcgcaaacgccatt
gtcctgatggattccgcgggcaactacgacccgcgcgacacaagcgagaagattggcatg
ctggccgctgaactggatgtgccggtcggctttcacgcccataacaatctggggctcgca
attgccaattcggttgctgcagccgaagcgggggcgaccatattggatggcactatgcgc
gggtttggggccggtgccggcaatacccagctggaggtgctctgcgcggtgctggaacgc
tacggctttgagaccggcaccgatgtttttgcgctctgcgaggcggtcgaggcgctgccg
gagctgccgccggtgcagcggcgcacgatcgtggggacctccaatctgatcagcggcatc
tatggcgtctgcgccggattcgaaaaacatgtgacccgtgcggcgcaggatttcggtgtc
gcgccccgctacatctacgaggaactgtcgcgctgcaacgccgttgccgggcaggaggat
ctgatcatctcagctgcggcgcacctgtccaagacgccacccgaaacatcggcgcaaccg
cgtaaaggagtgacagcatga

DBGET integrated database retrieval system