KEGG   Lodderomyces elongisporus: LELG_00093Help
Entry
LELG_00093        CDS       T01116                                 

Definition
(RefSeq) isocitrate dehydrogenase peroxisomal
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00020  Citrate cycle (TCA cycle)
lel00480  Glutathione metabolism
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01130  Biosynthesis of antibiotics
lel01200  Carbon metabolism
lel01210  2-Oxocarboxylic acid metabolism
lel01230  Biosynthesis of amino acids
lel04146  Peroxisome
Module
lel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lel_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LELG_00093
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LELG_00093
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    LELG_00093
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LELG_00093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 5235496
NCBI-ProteinID: XP_001527573
UniProt: A5DRV7
AA seq 412 aa AA seqDB search
MTETQKIKVKNPIVEMDGDEMTRIIWQFIKDKLILPYLDIDLKYYDLGIEYRDQTDDKVT
TDAAEAILKYGVGVKCATITPDEQRVEEFKLKKMWLSPNGTLRNILGGTVFREPIVIENI
PRIVPAWEKPIIIGRHAFGDQYKATDIIVPKAGELKLVFKPKDGSEIVEYPVYNFEGPGV
GLSMYNTDASISDFAESSFQLALERKLNLFSSTKNTILKKYDGRFKDIFENLYATKYKKQ
MDEAGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTP
DGKAFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLIQRGKLDKTPEVVKFAED
LEKAVIDTVAIDGKMTKDLALAQGKTARESYVTTEEFIDNVASRLNKNLGRS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacagagacacaaaaaatcaaggttaagaaccccattgtcgagatggacggtgacgaa
atgacccgcatcatttggcaattcatcaaagacaagttgatcttgccctacttggacatt
gacttgaaatactacgatttgggtattgagtatagagaccaaacagacgacaaggtcacc
acagacgccgcagaagccatcttgaaatacggtgttggtgtcaagtgcgccacaattacc
cccgatgagcaaagagttgaagaattcaagttgaaaaaaatgtggctctcgccaaatggt
accttgagaaacatccttggtggtaccgtatttagagaaccaattgttattgaaaacatt
ccaaggatcgtgccagcttgggaaaaaccaatcattatcggaagacacgcctttggcgac
caatacaaggccaccgacattattgtgcccaaagcaggggagttgaagttggtgtttaaa
ccaaaggatggcagcgaaattgtcgaatatccagtttacaactttgaaggtccaggtgtc
ggattgtcaatgtacaatacagatgcatctattagcgactttgccgagagttcatttcaa
ttggcccttgagcgtaagttgaacttgttctcatcgactaaaaacactatattgaaaaaa
tacgatggcagatttaaagatatctttgaaaacttgtatgccacaaagtacaagaaacaa
atggatgaagcaggaatctggtacgaacacagattgattgacgatatggttgcacaaatg
ttgaaatctaaaggtggttacatcattgccatgaaaaactatgatggtgacgtgcaatcc
gatatcgtggcccaaggttttggttcattgggtctcatgacctctgtcttggtcacccca
gatggtaaggcatttgaatctgaagcagcacacggtactgttacaagacactatagacaa
caccagcagggcaaggaaacatccaccaactcgattgcatcaatctttgcatggacaaga
ggcttgattcaaagaggtaagttggacaaaactccagaagttgtaaagtttgccgaagat
ttggaaaaggcggtcattgacactgttgccattgatggaaagatgactaaagatttggct
ttggcacagggcaaaactgcaagagaaagctatgtcactactgaagaatttattgacaat
gtcgcttctcgcttgaacaaaaatttgggtcgtagttag

DBGET integrated database retrieval system