KEGG   Lodderomyces elongisporus: LELG_00474Help
Entry
LELG_00474        CDS       T01116                                 

Definition
(RefSeq) anthranilate synthase component II
  KO
K01656  anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01130  Biosynthesis of antibiotics
lel01230  Biosynthesis of amino acids
Module
lel_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LELG_00474
Enzymes [BR:lel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LELG_00474
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     LELG_00474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS GATase Peptidase_C26
Motif
Other DBs
NCBI-GeneID: 5234977
NCBI-ProteinID: XP_001527954
UniProt: A5DSY8
AA seq 567 aa AA seqDB search
MLTLVLNHNQDESMTTISTKNTTKASTANASATAAVAGNAIVGTSAIKRHVLMIDNYDSF
TWNLYQYLHQSPRCGKVDVYRNDKIDIATIENKIKPDIIFISPGPGHPVTDSGISSDVIR
HFKGKLPIFGVCMGQECIFHVFGGDVSYAGEIVHGKTTTIKHDSKGMFEDIPQSVAVTRY
HSLAGSEKTLPECLEVTAVTETKPDVIMGVRHKKYTIEGVQFHPESILTESGQLMIDNLL
GIFGGTWEENEAYRMQAKKTRSANNFTKGENILKTIYDKRQEDYKVIENLPGRSFQNLEI
ALSLGAAPPVINFYERLKYTQDALKQTVILLEFKRASPSKGDINVSAHAGSQALTYAING
CSTISVLTEPNWFKGSLEDLSLIRQIIDGPKTKTIENYKRPAVLRKEFIFSKYQILEARL
AGADTVLLIVKMLNNQELLQELYSYSLELDMIPLVEVNDGPELEQALKLTYKGSTNEPLI
IGVNNRNLTNFDVDLGTTSLLVEHAKGSQNGRGGDVLILALSGITSVDDVKKYKYEDNVD
GFLIGESLMRAESKGQAGEFLHQLCNC
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgcttacattagttctcaaccacaaccaagacgagtcaatgacaacaatctcgacaaaa
aatacaaccaaagcgtcaactgcaaatgcatccgcaactgcagctgttgctggtaatgct
atagtggggacatcggcgatcaagagacatgtgcttatgattgataactacgattcattc
acctggaacttgtaccagtaccttcaccagtcgccaaggtgtggaaaagttgatgtttac
agaaatgataagatcgatattgcaaccattgaaaacaaaatcaagccagatatcatattc
atttcacctggtcccggccatcctgttacggattctggtatttccagtgatgtcattaga
cattttaaaggtaaattacccatttttggtgtttgtatgggtcaagagtgtatcttccat
gtctttggaggtgatgtttcctatgccggagagattgttcacggaaaaaccaccaccatt
aagcacgacagcaagggaatgtttgaggatataccacagtctgtagcggtaacaaggtac
cattctcttgcaggaagcgaaaagactttgccagagtgcttggaagtaacagcagttact
gaaacaaaacctgatgtgattatgggagtcagacacaagaagtatactatagaaggtgtg
cagttccaccctgaatctattttaacagaatctggccagcttatgattgacaatctattg
ggcatctttggcggcacctgggaagaaaacgaggcatatagaatgcaagcaaaaaagact
cgatctgctaataattttaccaagggcgagaacattttaaaaacaatatatgataagaga
caggaagattataaagtaattgagaatttgcctggccgttctttccaaaatttggaaata
gccttgtccctcggagcagctccgccagtcataaatttctacgaacgtttaaagtacaca
caagatgctcttaagcaaacggtgattctactggagttcaagagagccagtccttctaaa
ggcgatattaatgtgagtgcgcatgctggctctcaagcattgacgtatgctataaatggt
tgctcaacaatttcggtattaaccgaacctaattggttcaaaggatctttagaagactta
tctttgattcgacaaattatagatggaccaaaaacaaaaaccatagagaattacaagaga
cctgcagttttgagaaaagagtttattttcagcaagtaccagatcttagaggctcgatta
gccggtgccgatactgtactactcattgtaaaaatgctcaacaatcaagagttgttacaa
gaattatacagttactcattagagttggacatgataccactagtggaagtcaacgatggt
ccagaattggagcaagctttgaaattgacgtacaaagggtcaacgaacgagccgttgatt
ataggtgtcaacaatcgtaatttgacgaattttgatgtcgatctcggcactacaagtctg
ttggtcgagcatgccaagggaagtcagaatggccgaggtggtgatgtcttgattcttgcg
ttgtcaggaataacttcggtcgacgacgtcaagaaatataaatatgaagataatgttgat
ggttttttaattggtgagagtctcatgagagcggaatcaaaaggacaagcaggtgagttt
cttcaccaattgtgcaattgttag

DBGET integrated database retrieval system