KEGG   Lodderomyces elongisporus: LELG_01441Help
Entry
LELG_01441        CDS       T01116                                 

Definition
(RefSeq) succinyl-CoA ligase alpha-chain, mitochondrial precursor
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00020  Citrate cycle (TCA cycle)
lel00640  Propanoate metabolism
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01130  Biosynthesis of antibiotics
lel01200  Carbon metabolism
Module
lel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LELG_01441
   00640 Propanoate metabolism
    LELG_01441
Enzymes [BR:lel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     LELG_01441
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LELG_01441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 5233914
NCBI-ProteinID: XP_001526613
UniProt: A5DVQ5
AA seq 323 aa AA seqDB search
MLRQFARGFASSSPAKNYASTIPNLKINKDTKVIFQGFTGRQGTFHAEQAIAYGTDVVGG
INPKKAGQTHLDRPVFGTVAEAMKEAGATATGIFVPPPLAAGAIEEAIAAEIPLAVAITE
GIPQKDMVRVAQILKTQSKTRLVGPNCPGIISPDQCKIGIMPQSIFKRGKVGVVSKSGTL
TYEAVAQTTQVGLGQSLVIGMGGDPFPGTNFIDSLTLFLNDPETEGIILIGEIGGSAEEE
ASEFLKQHNLTRPEGAKPVVGFIAGVSAPPGRRMGHAGAIVAGGKGDAKSKIAALEAAGV
VVEKSPARLGNSLLAEFKNKGLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttgagacaattcgcccgtggatttgcatcctcatcccctgctaaaaactatgcttcc
acaattccaaacttgaagatcaacaaagacaccaaggttatcttccaaggtttcaccggt
agacaaggtactttccatgccgagcaagccattgcttatggtaccgatgttgttggtggt
atcaaccctaaaaaagctggtcaaacacacttggacagacctgtgtttggtactgttgct
gaagcaatgaaggaagctggtgccacggccactggtatctttgttccaccaccacttgct
gccggtgccattgaagaggctattgctgcggagattccattggctgttgcaatcaccgaa
ggtatcccacaaaaagatatggttagagttgctcagatcttgaagacacaaagtaaaacc
agattggtaggtccaaactgtccaggtatcatctcgccagaccaatgtaagattggtatt
atgccacagagtatcttcaagagaggtaaggttggtgttgtttccaaatcaggaaccttg
acatacgaagctgttgcacaaactacacaagttggcttgggtcaatctttggtcattggt
atgggtggtgatcctttcccaggtaccaactttatcgactcattgaccttgttcttgaac
gacccagaaactgaaggtatcatcttgattggtgagattggtggtagtgccgaagaagaa
gcatccgagtttttgaaacaacacaacttgaccagaccagaaggtgccaagccagttgtc
ggtttcatcgccggtgtttctgcacctccaggtagaagaatgggtcacgcgggtgccatt
gttgccggaggtaaaggtgatgccaaatcaaaaattgccgctttggaagctgccggtgtc
gtggtggagaaatctccagctagattgggtaactccttgttggctgagtttaagaacaag
ggtttattgtaa

DBGET integrated database retrieval system